Os07t0456900-01

Locus

Os07g0456900

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC65

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 65

Oryzabase Gene Symbol Synonym(s)

ONAC065, ONAC65

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 065, NAC domain-containing protein 65

Transcript Evidence

AK101301 (DDBJ, Best hit)

Protein Evidence

B8B5R1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J033033K06 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0456900-01)

RiceXPro (AK101301)

Others

Oryzabase (11493)

KEGG (Os07t0456900-01)

Transcript

2716 bp

>Os07t0456900-01 No apical meristem (NAM) protein domain containing protein.
GCTTCCGCCTCTCCTCGCCTCCTCCCTTCCTTTCCCCCCCAAACCCTAGAATTCCCCCCC
ACAAAACCCTAGAATTCGCGCGATCGAGGCGGCTATGGCGGCGGCCGCGGATGGGCTTCC
GCCGGGCGTCAGGTTCGACCCCGCCGACGACGAGCTCGTCTCCCGCTACCTGCTCCGGCG
CCTCCGGAAGCAGCCCATCCCGCTCCACGGCGTCATCCACGAGGCGGATCCCCTCGGCGC
gccgccatggatgctcctcgccgctcacggccggggcggcgacgaggccttcttcttcgc
cgaggcgcgcgccaagaacgtcagggggaagcggcAGAAGCGTACCGTCGAGGGTGGGGG
GTTCTGGCAGGGGCAGCGGGTGTGCATCGACGGCGAGAGGCTGCGCGTCCCCGGCGACGG
CGGCGGCGGCGAAGTCGGCGGGGAATTGGAGATCGAGTGGCGGAAGTACATGCTGAGCTT
CTTCGCCGAGGGGGAGAGGGGCAGCTCGGGGTGGGTGATGCACGAGTACGCCATCACGGC
GCCCGCTGACCTCGCCTCGTCGCCGATCCGGCTTTACCGCGTCCGGTTCAGCGGCCACGG
CAAGAAGCGCAAGCGGGAGCCGGAACGCCTGGGCGCCCGCGTCCACGACGACGACGTCGA
CGGTGGAGAACGCGCCGCGCCCCGGCGCGCCGTGGCAGAGACCGCCCTGTTCGTGCAGCA
GTCGAGCGCCGTGGATTGCGCCGAATCCGCCGATCAGAGCTTCTCCGGCGTGATCGAGCC
TGTGTTCCACGATCTCCCCGACATGATGCCAGAGCAAGCTGATGCCGGAGACACTGCAGA
GACTACAGCAGCGGTGGTGAACCTCACGGACGCCATGACCGAGCAGCCCGTTCTTCCGCT
AGCAGCAGATGGCGACGATCAGAGCTCCTACGGTGTCATCGATCCGGCGTTCCGCGATCT
TGCTGACCTGATGGTCCTGCCACCTGTGCTCGCGCAGCAGGAGCCTCCGCTCGCGCCCGT
GGCAATGGTGGATCTCCCTCCTGGCAATGCTGATTGCGCCGATCATCAGAGCTGCTCTGG
CGTGATCGACCCGGCGTTCCGTGATCTCCCCGACATGACCGTGCTGCCACCAGAGCAAGC
TGACACCGGAGGCGGAGCAGAGACTACCACAGCAATGGTGAGCCTCACGGACAAGCTGAA
ATACTCCTCCTCCATGGACGGCGAGGCAGCGCCGGCGTGGTGTGATTTCGATTTTCCAGA
GAGCACTGATGAGGTGCTCAGCTACATGAACTTCACCGCCGGTGCCCACGACAACAATGA
CGGCAGTGTGGGACGCGCCGCGCCATGGCGTCCCGTGTCAGAGATCGCCATGTTCGAGCA
GCCGAGCGCCGTGGATCTCCCTCCTGGCGATGCTGATTGCACTGAATCCGCCGATCAGAG
CTTCTCCGGCGTGATCGAGCCGGTGTTCCATGATCTCCCCGACATGATCCGTGAGCAAGC
TGATGCCGGAGACACCGCAGAGACTACTGCAGCGGTGGTGAACCAGAACTACTCCATGGC
GTTGTGTGATTTCGACAGCGGCATTGACTTCACCGCCGGCGCCCACGACAGCGGCATGGA
ACGCGCCACGCCCTGGACTCCCATGTCAGAGGCCGCCCTGTTCGAGCAGCAAGGGCCTCC
GCTCGCTCCCGCGGCAGTGGTGGATCTCCCTCCTGGCAATGCTGATTGTGCCGATCATCA
GAGCTCCTACGGTGACATGATCGTCCTGCCATCAGAGCAAGCTGGCGCCGGAGGCGGAGC
AGAGACTACCGAGGCCCTGTTCGACCAGCCCGTTCCGCCGCTTGCAGCAGATTGCGCCAA
TCAGGGCTCCTACGGCGTGATCGACCCGGTGTTCCGCGATCTCGCCGACTTGATCGTTCT
GCCACCAGAGCAGGCCGACGCCATGGACGGCGAGGCGGCGCCGGCGTGGTGTGATTTCGA
TTTTCCGGAGAACATTGATGAGGCGCTCAGCTACGTCGACTTCACCGCCGGCGCCCACGC
TGACAACGACGGTGGCGTGTCAGAGACCGCCATGTTCGAGCAGCCGGGGTCTCCGCCACA
GCACGATCCTCTGCTGATGGATGCTGATGGCGCCGATCAGAGCTCCTCCTCCGGCGCGCT
GATCGACACGGTGTTCGGTGATCACGCCGAACCGATCGTCCTGCCACTGGAGCAAGCTGA
CACCGGAGGTGGTGCAGCAGCGGCGGTGAAACTCATGGACAAGCAGAAGTACTCCTCCTC
CTCCATGGATGGCGAGGAGGCGCCGGCGTGGTGTGATTCGGATTTCCCGGAGAGCATTGA
CGAGGTGCTCAGCTATGTCGACTTCAGCACCGATGGCGCGAGCTGCGACTTCTCCATGGA
CGAGCTCTTCGATCTTGCAGATTAGTTAGCATCCTGGAGATAGCAAGCCACCAAGAACAC
TGGCATTGACATTGTCTTTCTAAGAAGAGCTGTAATCAGTAGCGCAAAGGCGAGATTTGT
TGATATTCTGGTGTAATCTGTAGACTAGAGGCAGAGTAGATAGATGTTCCTTAGTTTATT
GACTAATCTATGCATAGATGAGTTATTTGTTTATTGATTGAACTCAATGTAAGTAACATT
ATTGTAAGTAATGAATATACTCCCTTTTCAATCATTATATTCCCTATTCAAAATCAATAT
ACTGCATTGATCTGCC

CDS

2331 bp

>Os07t0456900-01 No apical meristem (NAM) protein domain containing protein.
ATGGCGGCGGCCGCGGATGGGCTTCCGCCGGGCGTCAGGTTCGACCCCGCCGACGACGAG
CTCGTCTCCCGCTACCTGCTCCGGCGCCTCCGGAAGCAGCCCATCCCGCTCCACGGCGTC
ATCCACGAGGCGGATCCCCTCGGCGCgccgccatggatgctcctcgccgctcacggccgg
ggcggcgacgaggccttcttcttcgccgaggcgcgcgccaagaacgtcagggggaagcgg
cAGAAGCGTACCGTCGAGGGTGGGGGGTTCTGGCAGGGGCAGCGGGTGTGCATCGACGGC
GAGAGGCTGCGCGTCCCCGGCGACGGCGGCGGCGGCGAAGTCGGCGGGGAATTGGAGATC
GAGTGGCGGAAGTACATGCTGAGCTTCTTCGCCGAGGGGGAGAGGGGCAGCTCGGGGTGG
GTGATGCACGAGTACGCCATCACGGCGCCCGCTGACCTCGCCTCGTCGCCGATCCGGCTT
TACCGCGTCCGGTTCAGCGGCCACGGCAAGAAGCGCAAGCGGGAGCCGGAACGCCTGGGC
GCCCGCGTCCACGACGACGACGTCGACGGTGGAGAACGCGCCGCGCCCCGGCGCGCCGTG
GCAGAGACCGCCCTGTTCGTGCAGCAGTCGAGCGCCGTGGATTGCGCCGAATCCGCCGAT
CAGAGCTTCTCCGGCGTGATCGAGCCTGTGTTCCACGATCTCCCCGACATGATGCCAGAG
CAAGCTGATGCCGGAGACACTGCAGAGACTACAGCAGCGGTGGTGAACCTCACGGACGCC
ATGACCGAGCAGCCCGTTCTTCCGCTAGCAGCAGATGGCGACGATCAGAGCTCCTACGGT
GTCATCGATCCGGCGTTCCGCGATCTTGCTGACCTGATGGTCCTGCCACCTGTGCTCGCG
CAGCAGGAGCCTCCGCTCGCGCCCGTGGCAATGGTGGATCTCCCTCCTGGCAATGCTGAT
TGCGCCGATCATCAGAGCTGCTCTGGCGTGATCGACCCGGCGTTCCGTGATCTCCCCGAC
ATGACCGTGCTGCCACCAGAGCAAGCTGACACCGGAGGCGGAGCAGAGACTACCACAGCA
ATGGTGAGCCTCACGGACAAGCTGAAATACTCCTCCTCCATGGACGGCGAGGCAGCGCCG
GCGTGGTGTGATTTCGATTTTCCAGAGAGCACTGATGAGGTGCTCAGCTACATGAACTTC
ACCGCCGGTGCCCACGACAACAATGACGGCAGTGTGGGACGCGCCGCGCCATGGCGTCCC
GTGTCAGAGATCGCCATGTTCGAGCAGCCGAGCGCCGTGGATCTCCCTCCTGGCGATGCT
GATTGCACTGAATCCGCCGATCAGAGCTTCTCCGGCGTGATCGAGCCGGTGTTCCATGAT
CTCCCCGACATGATCCGTGAGCAAGCTGATGCCGGAGACACCGCAGAGACTACTGCAGCG
GTGGTGAACCAGAACTACTCCATGGCGTTGTGTGATTTCGACAGCGGCATTGACTTCACC
GCCGGCGCCCACGACAGCGGCATGGAACGCGCCACGCCCTGGACTCCCATGTCAGAGGCC
GCCCTGTTCGAGCAGCAAGGGCCTCCGCTCGCTCCCGCGGCAGTGGTGGATCTCCCTCCT
GGCAATGCTGATTGTGCCGATCATCAGAGCTCCTACGGTGACATGATCGTCCTGCCATCA
GAGCAAGCTGGCGCCGGAGGCGGAGCAGAGACTACCGAGGCCCTGTTCGACCAGCCCGTT
CCGCCGCTTGCAGCAGATTGCGCCAATCAGGGCTCCTACGGCGTGATCGACCCGGTGTTC
CGCGATCTCGCCGACTTGATCGTTCTGCCACCAGAGCAGGCCGACGCCATGGACGGCGAG
GCGGCGCCGGCGTGGTGTGATTTCGATTTTCCGGAGAACATTGATGAGGCGCTCAGCTAC
GTCGACTTCACCGCCGGCGCCCACGCTGACAACGACGGTGGCGTGTCAGAGACCGCCATG
TTCGAGCAGCCGGGGTCTCCGCCACAGCACGATCCTCTGCTGATGGATGCTGATGGCGCC
GATCAGAGCTCCTCCTCCGGCGCGCTGATCGACACGGTGTTCGGTGATCACGCCGAACCG
ATCGTCCTGCCACTGGAGCAAGCTGACACCGGAGGTGGTGCAGCAGCGGCGGTGAAACTC
ATGGACAAGCAGAAGTACTCCTCCTCCTCCATGGATGGCGAGGAGGCGCCGGCGTGGTGT
GATTCGGATTTCCCGGAGAGCATTGACGAGGTGCTCAGCTATGTCGACTTCAGCACCGAT
GGCGCGAGCTGCGACTTCTCCATGGACGAGCTCTTCGATCTTGCAGATTAG

Protein

777 aa

>Os07t0456900-01 No apical meristem (NAM) protein domain containing protein.
MAAAADGLPPGVRFDPADDELVSRYLLRRLRKQPIPLHGVIHEADPLGAPPWMLLAAHGR
GGDEAFFFAEARAKNVRGKRQKRTVEGGGFWQGQRVCIDGERLRVPGDGGGGEVGGELEI
EWRKYMLSFFAEGERGSSGWVMHEYAITAPADLASSPIRLYRVRFSGHGKKRKREPERLG
ARVHDDDVDGGERAAPRRAVAETALFVQQSSAVDCAESADQSFSGVIEPVFHDLPDMMPE
QADAGDTAETTAAVVNLTDAMTEQPVLPLAADGDDQSSYGVIDPAFRDLADLMVLPPVLA
QQEPPLAPVAMVDLPPGNADCADHQSCSGVIDPAFRDLPDMTVLPPEQADTGGGAETTTA
MVSLTDKLKYSSSMDGEAAPAWCDFDFPESTDEVLSYMNFTAGAHDNNDGSVGRAAPWRP
VSEIAMFEQPSAVDLPPGDADCTESADQSFSGVIEPVFHDLPDMIREQADAGDTAETTAA
VVNQNYSMALCDFDSGIDFTAGAHDSGMERATPWTPMSEAALFEQQGPPLAPAAVVDLPP
GNADCADHQSSYGDMIVLPSEQAGAGGGAETTEALFDQPVPPLAADCANQGSYGVIDPVF
RDLADLIVLPPEQADAMDGEAAPAWCDFDFPENIDEALSYVDFTAGAHADNDGGVSETAM
FEQPGSPPQHDPLLMDADGADQSSSSGALIDTVFGDHAEPIVLPLEQADTGGGAAAAVKL
MDKQKYSSSSMDGEEAPAWCDSDFPESIDEVLSYVDFSTDGASCDFSMDELFDLAD*

5'UTR

chr07:15902053..15902146 (- strand) : 94 bp

CDS

chr07:15899722..15902052 (- strand) : 2331 bp

3'UTR

chr07:15899431..15899721 (- strand) : 291 bp

FASTA

>Os07t0456900-01 class=Sequence position=chr07:15899431..15902146 (- strand)
GCTTCCGCCT CTCCTCGCCT CCTCCCTTCC TTTCCCCCCC AAACCCTAGA ATTCCCCCCC ACAAAACCCT AGAATTCGCG
CGATCGAGGC GGCTATGGCG GCGGCCGCGG ATGGGCTTCC GCCGGGCGTC AGGTTCGACC CCGCCGACGA CGAGCTCGTC
TCCCGCTACC TGCTCCGGCG CCTCCGGAAG CAGCCCATCC CGCTCCACGG CGTCATCCAC GAGGCGGATC CCCTCGGCGC
gccgccatgg atgctcctcg ccgctcacgg ccggggcggc gacgaggcct tcttcttcgc cgaggcgcgc gccaagaacg
tcagggggaa gcggcAGAAG CGTACCGTCG AGGGTGGGGG GTTCTGGCAG GGGCAGCGGG TGTGCATCGA CGGCGAGAGG
CTGCGCGTCC CCGGCGACGG CGGCGGCGGC GAAGTCGGCG GGGAATTGGA GATCGAGTGG CGGAAGTACA TGCTGAGCTT
CTTCGCCGAG GGGGAGAGGG GCAGCTCGGG GTGGGTGATG CACGAGTACG CCATCACGGC GCCCGCTGAC CTCGCCTCGT
CGCCGATCCG GCTTTACCGC GTCCGGTTCA GCGGCCACGG CAAGAAGCGC AAGCGGGAGC CGGAACGCCT GGGCGCCCGC
GTCCACGACG ACGACGTCGA CGGTGGAGAA CGCGCCGCGC CCCGGCGCGC CGTGGCAGAG ACCGCCCTGT TCGTGCAGCA
GTCGAGCGCC GTGGATTGCG CCGAATCCGC CGATCAGAGC TTCTCCGGCG TGATCGAGCC TGTGTTCCAC GATCTCCCCG
ACATGATGCC AGAGCAAGCT GATGCCGGAG ACACTGCAGA GACTACAGCA GCGGTGGTGA ACCTCACGGA CGCCATGACC
GAGCAGCCCG TTCTTCCGCT AGCAGCAGAT GGCGACGATC AGAGCTCCTA CGGTGTCATC GATCCGGCGT TCCGCGATCT
TGCTGACCTG ATGGTCCTGC CACCTGTGCT CGCGCAGCAG GAGCCTCCGC TCGCGCCCGT GGCAATGGTG GATCTCCCTC
CTGGCAATGC TGATTGCGCC GATCATCAGA GCTGCTCTGG CGTGATCGAC CCGGCGTTCC GTGATCTCCC CGACATGACC
GTGCTGCCAC CAGAGCAAGC TGACACCGGA GGCGGAGCAG AGACTACCAC AGCAATGGTG AGCCTCACGG ACAAGCTGAA
ATACTCCTCC TCCATGGACG GCGAGGCAGC GCCGGCGTGG TGTGATTTCG ATTTTCCAGA GAGCACTGAT GAGGTGCTCA
GCTACATGAA CTTCACCGCC GGTGCCCACG ACAACAATGA CGGCAGTGTG GGACGCGCCG CGCCATGGCG TCCCGTGTCA
GAGATCGCCA TGTTCGAGCA GCCGAGCGCC GTGGATCTCC CTCCTGGCGA TGCTGATTGC ACTGAATCCG CCGATCAGAG
CTTCTCCGGC GTGATCGAGC CGGTGTTCCA TGATCTCCCC GACATGATCC GTGAGCAAGC TGATGCCGGA GACACCGCAG
AGACTACTGC AGCGGTGGTG AACCAGAACT ACTCCATGGC GTTGTGTGAT TTCGACAGCG GCATTGACTT CACCGCCGGC
GCCCACGACA GCGGCATGGA ACGCGCCACG CCCTGGACTC CCATGTCAGA GGCCGCCCTG TTCGAGCAGC AAGGGCCTCC
GCTCGCTCCC GCGGCAGTGG TGGATCTCCC TCCTGGCAAT GCTGATTGTG CCGATCATCA GAGCTCCTAC GGTGACATGA
TCGTCCTGCC ATCAGAGCAA GCTGGCGCCG GAGGCGGAGC AGAGACTACC GAGGCCCTGT TCGACCAGCC CGTTCCGCCG
CTTGCAGCAG ATTGCGCCAA TCAGGGCTCC TACGGCGTGA TCGACCCGGT GTTCCGCGAT CTCGCCGACT TGATCGTTCT
GCCACCAGAG CAGGCCGACG CCATGGACGG CGAGGCGGCG CCGGCGTGGT GTGATTTCGA TTTTCCGGAG AACATTGATG
AGGCGCTCAG CTACGTCGAC TTCACCGCCG GCGCCCACGC TGACAACGAC GGTGGCGTGT CAGAGACCGC CATGTTCGAG
CAGCCGGGGT CTCCGCCACA GCACGATCCT CTGCTGATGG ATGCTGATGG CGCCGATCAG AGCTCCTCCT CCGGCGCGCT
GATCGACACG GTGTTCGGTG ATCACGCCGA ACCGATCGTC CTGCCACTGG AGCAAGCTGA CACCGGAGGT GGTGCAGCAG
CGGCGGTGAA ACTCATGGAC AAGCAGAAGT ACTCCTCCTC CTCCATGGAT GGCGAGGAGG CGCCGGCGTG GTGTGATTCG
GATTTCCCGG AGAGCATTGA CGAGGTGCTC AGCTATGTCG ACTTCAGCAC CGATGGCGCG AGCTGCGACT TCTCCATGGA
CGAGCTCTTC GATCTTGCAG ATTAGTTAGC ATCCTGGAGA TAGCAAGCCA CCAAGAACAC TGGCATTGAC ATTGTCTTTC
TAAGAAGAGC TGTAATCAGT AGCGCAAAGG CGAGATTTGT TGATATTCTG GTGTAATCTG TAGACTAGAG GCAGAGTAGA
TAGATGTTCC TTAGTTTATT GACTAATCTA TGCATAGATG AGTTATTTGT TTATTGATTG AACTCAATGT AAGTAACATT
ATTGTAAGTA ATGAATATAC TCCCTTTTCA ATCATTATAT TCCCTATTCA AAATCAATAT ACTGCATTGA TCTGCC

Locus: Os07g0456900

Loading...

Locus: Os07g0456900

Loading...