Os07t0471100-01

Locus

Os07g0471100

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET26, SDG731

Oryzabase Gene Name Synonym(s)

SET protein 26

Transcript Evidence

AK103840 (DDBJ, Best hit)

Protein Evidence

B8B5Y2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Rubisco LS methyltransferase, substrate-binding domain (IPR015353)

Full-length cDNA

J033148I08 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0471100-01)

RiceXPro (AK103840)

Others

Oryzabase (13390)

KEGG (Os07t0471100-01)

Transcript

1832 bp

>Os07t0471100-01 SET domain containing protein.
GTAGTGACTAGTGGGCTTTACACAGCCAAATAATTCAGATTACCGTAAAACCTCCGCCCC
CAGCTAGCGGGCTGGTGTTTCCTCCGCCGCCGCCGCCGCAAATGGAGGCCCTCCTCCGGT
GGGCGGCGGAGCTGGGCGTCTCCGACTCCCCGTCCGCGCCCTCCCCCTCCTCCTGCCTCG
GCCGCTCCGTCCTCATCGCCGACTTCCCCGACGCCGGCGGGAGGGGCTTGGCGGCGGCGC
GGGACCTCCGGCGCGGCGAGCTGGTGCTGCGGGCGCCGCGCGCCGCCCTGCTCACCAGCG
GCCGCGTCATGGACGATGACCCCAGGATCGCCTCCTCCGTCGCCAGCCACCTCCCCCGCC
TCTCCTCCGTCCAGACCCTGATCATATGTTTGTTGTCTGAAGTGGGAAAAGGGAAGAGTT
CAAATTGGTATCTATATTTGTCTCAGCTGCCCTCCTACTACACTATCTTGGCTACCTTCA
ATGATTTTGAAACTGAAGCTCTCCAAGTTGATGAGGCTATTTGGGTTGCTCAAAAGGCTC
TTCGTGGAATAAGATCAGACTGGGAAGAAGCAACACCACTGATGAAAGGGTTGGGATTTA
AACCTAAGCTTTTGATGTTTAAATCATGGATCTGGGCTTTTGCAACGGTATCTTCAAGAA
CATTGCATATAGCATGGGATGATGCTGGTTGTCTATGTCCTATTGGTGATTTGTTCAATT
ATGCTGCTCCTAATGATGACAATTCATCAACGGATGAAGATAGAGATGATATGATGCATC
AGGAGACAAATAAGATGTTGGACCAGACAGATTTTGATTCATCTGAGAAGTTGACAGATG
GGGGATATGAAGATGTTAATGAATACCGTCTGTATGCTCGGAAAAGATATAGAAAAGGAG
AGCAGGTACTTCTGGCTTATGGAACGTATACAAACTTGGAACTTCTTGAGCATTATGGTT
TTCTTTTGGGTGAGAACCCTAATGAGAAAATCTACATTCCATTAGATTTGGATTTATGCA
TGATCGGTTCTTGGCCAAGAGATTCCTTGTATATTCTGCCAAATGGACATCCCTCATTTG
CATTGCTGTGTGCATTAAGGCTTTGGACAACTCCCAGAAATCGTCGGAAAGCCTTAAGTC
ATCAGATCTACTCTGGATCATTGTTATCTGTTGAAAATGAGCTGGAGATTCTGAAATGGT
TGGTCAAGAAGTGCAAGGAAACTTTGCAGCAATTACCTACGACTATAGAATTTGATGATA
ATTTGCTCGTCCTTTTATGCAAGCTACAGAACAGCACTAGCTGCATAACAGAAATGAACC
GGTCAATCTTTGAGCAAGAATTTGCTCCATTCTTCAGATTTCATGGCTTCAAGCTGGATT
GTTCTATACACAGTAAACTCCCAGTTCGTCTTCTACGATCCCTGGAAAGATGGGGATTAG
CTGTCCAGTGGAGATGCAACTACAAAAGAACCCTAACCAAGTGTATTGTGCACTGTAAAA
GTTTAGTTCACGAGCTTTCGTTGCAACAAAATCAACAATAGCTCAAAGATTCAAGCTAAC
TATGTTCTTTAGAATGCAGAAGTTCTTGATACAACAAAAATCAACAATAGCTCAAAGATT
CAAGCTAATTATGTTTTTTTAATGCAGAAGTTCTTGATACATTTTTGCTTAACAGCATGT
CAAATTGTCAACACTCGATAGCAGGGCGAGGTGCTTTCATAGTTCCATGCATCACACTTT
TTGGGGTTGCATAGTTTAAGCATAACAAGCGTTCTGTGGAATGCCTTCTGTGGAATGCCG
CTGAGATACTGATAATTGATTATCAGGCATGC

CDS

1440 bp

>Os07t0471100-01 SET domain containing protein.
ATGGAGGCCCTCCTCCGGTGGGCGGCGGAGCTGGGCGTCTCCGACTCCCCGTCCGCGCCC
TCCCCCTCCTCCTGCCTCGGCCGCTCCGTCCTCATCGCCGACTTCCCCGACGCCGGCGGG
AGGGGCTTGGCGGCGGCGCGGGACCTCCGGCGCGGCGAGCTGGTGCTGCGGGCGCCGCGC
GCCGCCCTGCTCACCAGCGGCCGCGTCATGGACGATGACCCCAGGATCGCCTCCTCCGTC
GCCAGCCACCTCCCCCGCCTCTCCTCCGTCCAGACCCTGATCATATGTTTGTTGTCTGAA
GTGGGAAAAGGGAAGAGTTCAAATTGGTATCTATATTTGTCTCAGCTGCCCTCCTACTAC
ACTATCTTGGCTACCTTCAATGATTTTGAAACTGAAGCTCTCCAAGTTGATGAGGCTATT
TGGGTTGCTCAAAAGGCTCTTCGTGGAATAAGATCAGACTGGGAAGAAGCAACACCACTG
ATGAAAGGGTTGGGATTTAAACCTAAGCTTTTGATGTTTAAATCATGGATCTGGGCTTTT
GCAACGGTATCTTCAAGAACATTGCATATAGCATGGGATGATGCTGGTTGTCTATGTCCT
ATTGGTGATTTGTTCAATTATGCTGCTCCTAATGATGACAATTCATCAACGGATGAAGAT
AGAGATGATATGATGCATCAGGAGACAAATAAGATGTTGGACCAGACAGATTTTGATTCA
TCTGAGAAGTTGACAGATGGGGGATATGAAGATGTTAATGAATACCGTCTGTATGCTCGG
AAAAGATATAGAAAAGGAGAGCAGGTACTTCTGGCTTATGGAACGTATACAAACTTGGAA
CTTCTTGAGCATTATGGTTTTCTTTTGGGTGAGAACCCTAATGAGAAAATCTACATTCCA
TTAGATTTGGATTTATGCATGATCGGTTCTTGGCCAAGAGATTCCTTGTATATTCTGCCA
AATGGACATCCCTCATTTGCATTGCTGTGTGCATTAAGGCTTTGGACAACTCCCAGAAAT
CGTCGGAAAGCCTTAAGTCATCAGATCTACTCTGGATCATTGTTATCTGTTGAAAATGAG
CTGGAGATTCTGAAATGGTTGGTCAAGAAGTGCAAGGAAACTTTGCAGCAATTACCTACG
ACTATAGAATTTGATGATAATTTGCTCGTCCTTTTATGCAAGCTACAGAACAGCACTAGC
TGCATAACAGAAATGAACCGGTCAATCTTTGAGCAAGAATTTGCTCCATTCTTCAGATTT
CATGGCTTCAAGCTGGATTGTTCTATACACAGTAAACTCCCAGTTCGTCTTCTACGATCC
CTGGAAAGATGGGGATTAGCTGTCCAGTGGAGATGCAACTACAAAAGAACCCTAACCAAG
TGTATTGTGCACTGTAAAAGTTTAGTTCACGAGCTTTCGTTGCAACAAAATCAACAATAG

Protein

480 aa

>Os07t0471100-01 SET domain containing protein.
MEALLRWAAELGVSDSPSAPSPSSCLGRSVLIADFPDAGGRGLAAARDLRRGELVLRAPR
AALLTSGRVMDDDPRIASSVASHLPRLSSVQTLIICLLSEVGKGKSSNWYLYLSQLPSYY
TILATFNDFETEALQVDEAIWVAQKALRGIRSDWEEATPLMKGLGFKPKLLMFKSWIWAF
ATVSSRTLHIAWDDAGCLCPIGDLFNYAAPNDDNSSTDEDRDDMMHQETNKMLDQTDFDS
SEKLTDGGYEDVNEYRLYARKRYRKGEQVLLAYGTYTNLELLEHYGFLLGENPNEKIYIP
LDLDLCMIGSWPRDSLYILPNGHPSFALLCALRLWTTPRNRRKALSHQIYSGSLLSVENE
LEILKWLVKKCKETLQQLPTTIEFDDNLLVLLCKLQNSTSCITEMNRSIFEQEFAPFFRF
HGFKLDCSIHSKLPVRLLRSLERWGLAVQWRCNYKRTLTKCIVHCKSLVHELSLQQNQQ*

5'UTR

chr07:16886901..16887001 (+ strand) : 101 bp

CDS

chr07:16887002..16887120 (+ strand) : 119 bp

chr07:16887217..16887370 (+ strand) : 154 bp

chr07:16888329..16888460 (+ strand) : 132 bp

chr07:16888543..16888683 (+ strand) : 141 bp

chr07:16889050..16889307 (+ strand) : 258 bp

chr07:16889436..16890071 (+ strand) : 636 bp

3'UTR

chr07:16890072..16890362 (+ strand) : 291 bp

FASTA

>Os07t0471100-01 class=Sequence position=chr07:16886901..16890362 (+ strand)
GTAGTGACTA GTGGGCTTTA CACAGCCAAA TAATTCAGAT TACCGTAAAA CCTCCGCCCC CAGCTAGCGG GCTGGTGTTT
CCTCCGCCGC CGCCGCCGCA AATGGAGGCC CTCCTCCGGT GGGCGGCGGA GCTGGGCGTC TCCGACTCCC CGTCCGCGCC
CTCCCCCTCC TCCTGCCTCG GCCGCTCCGT CCTCATCGCC GACTTCCCCG ACGCCGGCGG GTAAAAACCC CTCCCTCTCC
CTCTCCACCC AAACCCTAAT CTGCCTGTGT TCACCGCCTT TTGCGCTTCC TCGCGCCGTT TGGTTTCCCA CCTCAGGAGG
GGCTTGGCGG CGGCGCGGGA CCTCCGGCGC GGCGAGCTGG TGCTGCGGGC GCCGCGCGCC GCCCTGCTCA CCAGCGGCCG
CGTCATGGAC GATGACCCCA GGATCGCCTC CTCCGTCGCC AGCCACCTCC CCCGCCTCTC CTCCGTCCAG GTAATTTCAT
ATGCCTATGT CAGGCTGTCT TCGAATTGAC TTGAGTTGTT GGATGGTTTC GATTTGGAGT GCATTGCTCT CGTTGTTTCC
GCAACAGTGG AGTGCGTTGC TCATGGTGGT GGTAGGTTAA TACCATATTA AATCTTTGGA TGCACCGGAG AATTCGCAAA
ATGTGCCGGC ACGATAAAGG CATCATGAAT ACTGGAGTTG GAATAACCAT ATGCTTCTCA CAATAAATCT TGTGAAATAA
ATTTGTGCGA AGAGGCACGG CCTTGGCTTT GAGAAGACCA GAAACAAGTC TGGCCTTAAG CGCACCGCAG TTGCAGGAAC
CAAATGCTGC AGACAGTTGG TGTGCtaaga gcaggtacaa tagcaggcta taagccagct gcaaacatat tttaaggaga
taaatcagga gagagaagag cagcgggcta cagatttgta gccagctgta gcacggactc caagacgcag tgtgtctatg
acagttgggg ctaggtatta atagtgtagc atgtaactat tgtataaatg agctattaga ttggctatag atgagttgga
gttagtagtt ggctaaacta ttgaacttgc tctaaTCCAT TAGATTGGCT CTACATATGT TGAATTGGTT TCACTATTAT
GTTTCAGTTT GGACAAAAAG ATTGGATGGA TTTGGCAATT TTGGGGAGGG TAAAAAGATC ACACTAACAC ATACTAGTAA
TTTACTAGAT AAAATGAAAA TGAAAATCTT CGACACAAAT AACTCTATCG TGATGTCTTG ATGATTCTAT TTTTTATTTG
ACTTCGAAAG TGTCAACTCA ATCTTGGCCT TTCTATGCCC CTTTTGATCT TGTAAGGGCA ATGAAAGAAA CTTTCATGCT
TGGTCTCCTT ATCACATCTT TTCAATTGCT TCAATGCTTT CACTGATATT CCCTTTGTAT CTGAGCAGAC CCTGATCATA
TGTTTGTTGT CTGAAGTGGG AAAAGGGAAG AGTTCAAATT GGTATCTATA TTTGTCTCAG CTGCCCTCCT ACTACACTAT
CTTGGCTACC TTCAATGATT TTGAAACTGA AGCTCTCCAA GTACAACTCG GTAGTTCTGT CTACAAAATT TTAGTTTTCC
ATTTCGATTG CTTCATGTTA CATTCAGCTT ACTTCTTTTC AGGTTGATGA GGCTATTTGG GTTGCTCAAA AGGCTCTTCG
TGGAATAAGA TCAGACTGGG AAGAAGCAAC ACCACTGATG AAAGGGTTGG GATTTAAACC TAAGCTTTTG ATGTTTAAAT
CATGGATCTG GGCTTTTGCA ACGGTATAGT TTTTTGAATT TTAGCTCAGT TTATACCAGT TCTCTTTGTT GTTTGACATA
CCAGCTTTGC TGTCTAGTTT TTTGTAAGGG AGTTTGTCGT CTAGTTTAGT TACTGCATAG AATGAAAGTA ATGGAACTCA
CCTTACCTTT TGTTTTTTAA CATGGCTCTG AGTTTTGTAA CGTTACATTT ATATATTCCT TGCACGGGGA TAGCCTTTCT
CTTTCATATT TGACATGCTA GCTTTGTAGC CACTACAATG AATCTCTGCT GACTCAAGAA TTTTATAAGT TTGTTAGTCT
TAATTTCTGT TCTATATTTT CATGGTGGAA AGGTATGAGG TTTCTGAAGT TTCTTTTGAC AACTTGAAGG TATCTTCAAG
AACATTGCAT ATAGCATGGG ATGATGCTGG TTGTCTATGT CCTATTGGTG ATTTGTTCAA TTATGCTGCT CCTAATGATG
ACAATTCATC AACGGATGAA GATAGAGATG ATATGATGCA TCAGGAGACA AATAAGATGT TGGACCAGAC AGATTTTGAT
TCATCTGAGA AGTTGACAGA TGGGGGATAT GAAGATGTTA ATGAATACCG TCTGTATGCT CGGAAAAGAT ATAGAAAAGG
AGAGCAGGTT TCTTCTGATA TTTGCCTAAA ATATATGCCC TTTTTTGTCT ATAGGATGCT CATGTTCTCC CGTATCACAT
TATCTGCCTT CTTGTTGTTC TGTACTTTTG AATTAAACTT TGTCCTTTCG TACAGGTACT TCTGGCTTAT GGAACGTATA
CAAACTTGGA ACTTCTTGAG CATTATGGTT TTCTTTTGGG TGAGAACCCT AATGAGAAAA TCTACATTCC ATTAGATTTG
GATTTATGCA TGATCGGTTC TTGGCCAAGA GATTCCTTGT ATATTCTGCC AAATGGACAT CCCTCATTTG CATTGCTGTG
TGCATTAAGG CTTTGGACAA CTCCCAGAAA TCGTCGGAAA GCCTTAAGTC ATCAGATCTA CTCTGGATCA TTGTTATCTG
TTGAAAATGA GCTGGAGATT CTGAAATGGT TGGTCAAGAA GTGCAAGGAA ACTTTGCAGC AATTACCTAC GACTATAGAA
TTTGATGATA ATTTGCTCGT CCTTTTATGC AAGCTACAGA ACAGCACTAG CTGCATAACA GAAATGAACC GGTCAATCTT
TGAGCAAGAA TTTGCTCCAT TCTTCAGATT TCATGGCTTC AAGCTGGATT GTTCTATACA CAGTAAACTC CCAGTTCGTC
TTCTACGATC CCTGGAAAGA TGGGGATTAG CTGTCCAGTG GAGATGCAAC TACAAAAGAA CCCTAACCAA GTGTATTGTG
CACTGTAAAA GTTTAGTTCA CGAGCTTTCG TTGCAACAAA ATCAACAATA GCTCAAAGAT TCAAGCTAAC TATGTTCTTT
AGAATGCAGA AGTTCTTGAT ACAACAAAAA TCAACAATAG CTCAAAGATT CAAGCTAATT ATGTTTTTTT AATGCAGAAG
TTCTTGATAC ATTTTTGCTT AACAGCATGT CAAATTGTCA ACACTCGATA GCAGGGCGAG GTGCTTTCAT AGTTCCATGC
ATCACACTTT TTGGGGTTGC ATAGTTTAAG CATAACAAGC GTTCTGTGGA ATGCCTTCTG TGGAATGCCG CTGAGATACT
GATAATTGAT TATCAGGCAT GC

Locus: Os07g0471100

Loading...

Locus: Os07g0471100

Loading...