Os07t0476500-01

Locus

Os07g0476500

Description

Cyclophilin 21 protein, Oxidative stress tolerance, Regulation of peroxidase activity

RAP-DB Gene Symbol Synonym(s)

OsCYP21-4

RAP-DB Gene Name Synonym(s)

cyclophilin 21-4

CGSNL Gene Symbol

CYP21-4

CGSNL Gene Name

CYCLOPHILIN 21-4

Oryzabase Gene Symbol Synonym(s)

OsCYP21-4, OsCYP-19, OsCYP21-2a, OsCYP21-2b, OsCYP21-2c

Oryzabase Gene Name Synonym(s)

cyclophilin 21-4, cyclophilin 19

Transcript Evidence

AK066346

Protein Evidence

Q7EYT3

Literature

PMID: 31786704

PMID: 26483814

Note

Manual Curation

December 3, 2019

Gene Ontology (GO)

Biological Process: protein peptidyl-prolyl isomerization (GO:0000413)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Cyclophilin-like domain superfamily (IPR029000)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase (IPR024936)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain (IPR002130)

Experimentally confirmed subcellular location

Golgi cis cisternae (GO:0000137)

Golgi trans cisternae (GO:0000138)

Full-length cDNA

J013061P09 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0476500-01)

RiceXPro (AK066346)

Others

Oryzabase (10063)

KEGG (Os07t0476500-01 (EC:5.2.1.8))

Transcript

1215 bp

>Os07t0476500-01 Cyclophilin 21 protein, Oxidative stress tolerance, Regulation of peroxidase activity
CTTTTCCAACCCAACCTCAAACACAACCAATCCACCTCCGATTCCTTCATCCGCCGCCAC
CGCCGCCGTCGCCGCCGCCGGGATCCCGCCCGCAACCGCACCGCGGCGGCTCCTTCCCTT
CCTCCAGGTACCAACCAGATTGTGGGATCTTCCTAGAGAGCGCTGTTGTCCTGCACGAGT
AGAATAGCAGATGGCGAGGATAAAGCCGAAGCAATTGCTAATTCAAAGCAAGACGAAGAA
GGCCCCAACACGGATCAGTTACTCCACTATCGTTACTTGGAACCTAATTGTTATCTTGGT
TGCGCTATCCCTCTATGCTACCTACAGGCATTGGCATCACAGGCCAATGCTCGAGACTGA
AATGGATCTCCCTCGTGCTGAGCATGTTGGAAGATCTGAGGATTCCACGAAGACTAGTAG
ACCAAGCTATGCGGTTATTGATACTGCCAAAGGCTCAATTACTATAGAAATTTACAAAGA
TGCTTCTGCTGATGTTGTGGATAGATTTGTTAGCTTGTGCAAGAGTAACCATTTTAAAGG
AATGCCGTTTCGTCATGTCATCAAAAACTTTGTAATTCAAGGGGGTGATTTCGATTTCAA
TGGTGCTGCCCAGGAATGGATACTGAAAGCCAAAGCCAGTGGAGAAAACGCTCTAAGTCC
AAAGCACGAGGCATTCATGATCGGGACTACGAAGAATCCTAATAATAAAGGATTTGATCT
TTTTATCACAACTGCTCCAATTCCTGACTTGAATGACAAGCTTGTTGTATTTGGGCAAGT
TATCAATGGACAAGATATTGTTCAGGAGATCGAAGAAGTTGATACTGATGAGCATTACCA
GCCAAAAACCCCTATCGGCATACTCAACATCACGCTAAAACAGCAAGCTTTGAGCTGATA
GCTTGTTGTCCTTACCTGAAAATGACTTATCTGTACTCCAAGAGGGTCCATACATCGCCT
CCAATTGCTGCTGAAATTGATTATGATTATGGCTTCCTCTAGAAGCCCATGGGTTGCAAA
GAAAGAAGGCGCTTAATCTTGCCTGGCAGCTAAAAGCTTCTTCCGTCTCATGGAGTAGTT
GTGTATAAATTTATCCCTGGTGTCATTCGGCTGTCAGTTTTTGCAGGCATTACAGTGTAT
TTTGATGCTTGGTTGTTTCATTGTAAATTTGAAGCCCATTTGGATCATGAATCATAGAAC
TTGGAATTCATAGTT

CDS

708 bp

>Os07t0476500-01 Cyclophilin 21 protein, Oxidative stress tolerance, Regulation of peroxidase activity
ATGGCGAGGATAAAGCCGAAGCAATTGCTAATTCAAAGCAAGACGAAGAAGGCCCCAACA
CGGATCAGTTACTCCACTATCGTTACTTGGAACCTAATTGTTATCTTGGTTGCGCTATCC
CTCTATGCTACCTACAGGCATTGGCATCACAGGCCAATGCTCGAGACTGAAATGGATCTC
CCTCGTGCTGAGCATGTTGGAAGATCTGAGGATTCCACGAAGACTAGTAGACCAAGCTAT
GCGGTTATTGATACTGCCAAAGGCTCAATTACTATAGAAATTTACAAAGATGCTTCTGCT
GATGTTGTGGATAGATTTGTTAGCTTGTGCAAGAGTAACCATTTTAAAGGAATGCCGTTT
CGTCATGTCATCAAAAACTTTGTAATTCAAGGGGGTGATTTCGATTTCAATGGTGCTGCC
CAGGAATGGATACTGAAAGCCAAAGCCAGTGGAGAAAACGCTCTAAGTCCAAAGCACGAG
GCATTCATGATCGGGACTACGAAGAATCCTAATAATAAAGGATTTGATCTTTTTATCACA
ACTGCTCCAATTCCTGACTTGAATGACAAGCTTGTTGTATTTGGGCAAGTTATCAATGGA
CAAGATATTGTTCAGGAGATCGAAGAAGTTGATACTGATGAGCATTACCAGCCAAAAACC
CCTATCGGCATACTCAACATCACGCTAAAACAGCAAGCTTTGAGCTGA

Protein

236 aa

>Os07t0476500-01 Cyclophilin 21 protein, Oxidative stress tolerance, Regulation of peroxidase activity
MARIKPKQLLIQSKTKKAPTRISYSTIVTWNLIVILVALSLYATYRHWHHRPMLETEMDL
PRAEHVGRSEDSTKTSRPSYAVIDTAKGSITIEIYKDASADVVDRFVSLCKSNHFKGMPF
RHVIKNFVIQGGDFDFNGAAQEWILKAKASGENALSPKHEAFMIGTTKNPNNKGFDLFIT
TAPIPDLNDKLVVFGQVINGQDIVQEIEEVDTDEHYQPKTPIGILNITLKQQALS*

5'UTR

chr07:17260419..17260556 (- strand) : 138 bp

chr07:17259661..17259712 (- strand) : 52 bp

CDS

chr07:17259509..17259660 (- strand) : 152 bp

chr07:17259353..17259392 (- strand) : 40 bp

chr07:17258812..17258862 (- strand) : 51 bp

chr07:17257910..17257995 (- strand) : 86 bp

chr07:17256016..17256153 (- strand) : 138 bp

chr07:17255764..17255911 (- strand) : 148 bp

chr07:17255290..17255382 (- strand) : 93 bp

3'UTR

chr07:17254973..17255289 (- strand) : 317 bp

FASTA

>Os07t0476500-01 class=Sequence position=chr07:17254973..17260556 (- strand)
CTTTTCCAAC CCAACCTCAA ACACAACCAA TCCACCTCCG ATTCCTTCAT CCGCCGCCAC CGCCGCCGTC GCCGCCGCCG
GGATCCCGCC CGCAACCGCA CCGCGGCGGC TCCTTCCCTT CCTCCAGGTA CCAACCAGGT GCGTGCGCCC GCTGCCCATC
TCTCCCTCGC TCTCCCGCCC CCCGCGGAGG CTGGCGCGGG GAGATCTCCG GCGTCCTAGG GCTTCGGCTG CAGCTCTGGC
TGCTGCTTGG TGCTTAATTC GCGCGCTGCC GAATTTGATT GATTCCCTCC TCGATCGCCA CTTCGTGCCT GAGTTTTTCG
GCCCCCCCCC CCCCCCCCCC CCCCCCGCCT CGTGGCCGTC GGTGCCTTGG GCGTGAGCGA CGAAGGGGAG ACGATTTGGG
TGGGGGAGCA GTTGGAGCAC ACGCTCTTCG TGGGTGGGTT TCGCTGTTGC TCCAGCGCAG CACATCTAGA GGAGGCGAGG
AGAATTGGGG AAACTGGTAG AGGAGGAGGA GGAGGGGTCC TCACCTCCCT CTCTTTTAGC TAGCGTGATG GATTGTTAGG
GTTAGCTGCT AAGGTCTCGG TACCGTCCCT CACTTTGAGG TTTGAGGCTG CTGCAACTGG TCGTTGGATA AATTGCCACC
GCGAAAAAGG TTAGAGAAGC TACCGATTCT TTGGGTAGAT TGCTTTTCAG ATAGATTGTG GTATATCCTA CTACTTCAGA
TTGCTTGCCG ACGACGCCAA AACGGCAGCC TTTTTAGCTG ACCTAATGTT GCAAATTTTA GTTAAGTTTT TTCAAGGTCT
TGCTGCTGGC TGCTTCTACT GAACAATTGT TTTTTCATTC CTAGATTGTG GGATCTTCCT AGAGAGCGCT GTTGTCCTGC
ACGAGTAGAA TAGCAGATGG CGAGGATAAA GCCGAAGCAA TTGCTAATTC AAAGCAAGAC GAAGAAGGCC CCAACACGGA
TCAGTTACTC CACTATCGTT ACTTGGAACC TAATTGTTAT CTTGGTTGCG CTATCCCTCT ATGCTACCTA CAGGCATTGG
CATCACAGGT TAGTGCCCTT TCTTGCAATA TTTGTTGATT TGCTGATTTA GTAGCTAGTC CCAAGCACAA TTGATCTAGC
TTTACTTGCT TTTTGACTTC CTTCACTGAT GAGATACCTC ACAGGCCAAT GCTCGAGACT GAAATGGATC TCCCTCGTGC
TGAGGTACGC TAAACAATCT AGTTCATGCC CTATATGCTC TTCTTGTCTT GCTTTGTCTC CAAGTACTTC CTCCTTTATG
CCAATGACAT GACATGTTTG GGTCTTGGAA AACACCGTGT CTCTGCCTTT TCTGAATCAT TGATCCTAGC ATTTTGTTTT
CCATCTATTT TGAAAACCTT CTTGTTCTAT ATTTAATGTC CAAATCATAT GTATAGTTAA TGACCATTGG AACTTCTGTG
TTAGTGTTGT AAAATGAGCC ATGGTAAACC TTGTTTGCAG CAAATACATG TGTCTTCCTT TTCTTATATA GGTTCGATAA
TATGCTATGT TATAAATATG ACATTTTCTA TGGACTTGCA ATGGCTTCTG TAGGTGATTT GTGTCCTTAT ATACATTTTT
TTAGAATGAC GATATCTGCT GATACGAGCC ATACTCAATC TGACATCAAA TTCATTGATT TTATTCTCTT ATGTGTTCTC
TTCCTGACTT CCAGCATGTT GGAAGATCTG AGGATTCCAC GAAGACTAGT AGACCAAGCT ATGCGGTAAG TTGTACTATT
TTCCTTTCAC AGGACAAGAT TTCTGACCAA CTTAGCAGCA TATGATGTTA ATAAAAATTA TATGCCCGAT TGTCTTTTAA
GTGTGTTGTT AGTATATATC GGGTCAATTT ACAATTGTAC ATGGTACGTT AATTATGTCT TGCTCTTCTG TTGGTCTGGT
AGTGACTGCT ATACCAGGTT TTGATCTAAA TCTTGTGGTA TGTTATGCTT TGGAAATGTT GCAATCAACT ATTTTCCTGC
TTAAAGTAGA ATCGAAAATA AGTACACCAT GCATGGATAT AAACAAATTA TCCTTAGGGT AGTCCTTTCC TTATGCACAA
ACCCTGAACT CCTGAAGGCC TTAACAAGAT AAAGAAAACT ATCCTTGCCA TTGTTGGATT AATCATCAAG TTTTAAATAA
TCAAAACTCC ATAAAAAGAC GATGAACTAG TGTTCATCCG GAATTTAGTA GGTTAAGTAG TAATAGTTTT ACAGGCTTGA
AATGCTTCTG CCAAATGTAG TTAATACTTT CATATCTTAA ACATTGTGGT TTTATGCTGC AGAACTAGAC CTGATGCACA
TCCTTTTCTT GTTATGAACT TATGATGTTT GGATGCTAAT TATTAGCAGT ACAAGCATAC AATTAGTAAG AGAAGTAGAT
TGTATGCTAT TGCCTGTAAA TATAGGAAAT TAAATCTGAT GCATATAACC TTTTTTTATG GGAATTTGTG CATATGACCT
TACTGAGTAG ACATAAAATA TTTAATGCAA CAATCTTAAG CATTCACTGA ACATAATGCT ATTGTAATTT TCTTCCTCCA
GGTTATTGAT ACTGCCAAAG GCTCAATTAC TATAGAAATT TACAAAGATG CTTCTGCTGA TGTTGTGGAT AGATTTGTTA
GCTTGTGGTG AGCACTGGAA TCTTTGCTTA ATCTTGTTTT ATACTTTTAC ATGATAATGC TACATGGATG TTGACTTGTC
TATGATCATT TTTGGGGCAT TATTTGTTTG TGTTGGACTC TCTGGCTATC CGCAGTGGTG CAATTCCACA CAAACATGTC
ATATTCAGTC CCTCTGATTA TTTCATGAAA GATACAATTA GAGTATAAGT ATCTAGATAT GTAATCCATA TAATTTTAAG
ATGGATTGTT GATAAATATA TAAGGCTTGC ATGCAAATTT AAAGGTCCTT TTCCTATCAT GCTCCTATTG ATGGTAACTT
GCATAGTCCA CCCATACAAA GCATCCACTC TCTTCTTTTC CAAAACAGTT ACTAAAATGC ATTTTTAGTT CCAAACTCTC
CTACTTTCTC AATTTCGTAA GCTCCTTAAT TCTTACTCAG TCAAATAGAC CCCTATTGAT TTATGAAGGG AGCATGAGCT
ATTAAACTTT CTTCAAGATT TTACACAAGA AGTTTTCAGC AAAAGGGTGT GCACTTCTCC CTCTAGTGTA CCTCTTTTTG
TGGACAGATT CTTCTGTGTT CCCTATTCCT TTCCTTTGCA AAATTTCTTT CTTTTCTTGT GTTCTTGGCA TCAGCTTTAT
TTCTTTGAAT ACTTTGATCA TAATGGATCT TTCTATTTTA TTGATAACAC ATCACACATT GCAGTAATGA GTTAGACAGC
TAGTGATCGC AGCATCATGA TACTATTAAT ATGGTTGATA GTCTAGGCAC TTGTTTTGGA TCCAAATAGA TGAAGTTGGT
TGCTTGTATC TTGCATAAAT GAATGATACC TTAGAGTTTG CAGCAGAATA TATAAACCTT TATGGTTGCA TGCAAGGTTC
TTGAATCCAG TTTCTTGTAA AGATATTGCT TGGTAGGCTA TTCCTGTGTC ATTAGTCATG CAAAGAATGT AATCAAAGCA
ACAAATGAAA TCTTTTTAGA GGTTGATGAA TTGAAATCTG AAGACAACTG TATTCTACAA TACTTCCAAG GCAAAAAAAC
ACTACATTTT ATTTGTGAAG TGCTTTTATG CTCACCGAAA GCAAGATCAC ATGAACTTCA ATGCGAGTAA TTTGAAGCAG
GCTCATCATG CTCACCGATT AGCAACTCTA AATGCTTAAT GCTCACAATA TTTGTTCTTT GAGGTCAAGA AGCCAACTAT
GATTTATTAA GTACAGTGTG ATAAACTGGT TTTGGTTTTG AATATGCGAT GTATGATAAA CTGTAGTCTG AGATGAGATG
ATGCTTTACA TGTAGCAGCG TGTTTGTAGC GCAAACATAT TTGCtactcc ctccgtttcg aaatgtttga caccgttgac
tttttagcac atgtttgacc gttcgtctta ttcaaaaact tttgtgaaat atataaaatt atatgcctac ataaaaatat
atttaacaat gaatcaaatg atagaaaaag aattaataat tacttaaatt ttttgaataa gacgaacggt caaacatgtg
ctaaaaaatc aatggcgtca aacatttcga aacggaggga GTATTATGGT ATTTGTTATT TGTACCATAT TGCCCTTCAG
GATGTCTCGT AGTCTAAGAG TAACTAGTAC AATTTCTCTA GGCTTGCATT GCTGGAAGGA ATCATGTTTC AAAGGAGAAT
AGCACACATG TTAAGAATTT ATCAAGATAA ATTATCCTTT TGTCCTCTTT GGATTATCAT CTAACATTTG TTTCAATTGC
CAGCAAGAGT AACCATTTTA AAGGAATGCC GTTTCGTCAT GTCATCAAAA ACTTTGTAAT TCAAGGGGGT GATTTCGATT
TCAATGGTGC TGCCCAGGAA TGGATACTGA AAGCCAAAGC CAGTGGAGAA AACGCTCTAA GGTTTGTCCC CAAATCAATG
CACATATAGA ATTCTGTTGA AAAGTCTTGG TTTTGCCAGA CTTATTTTTT TTCTTTACAC TACGTGTATT TCTATGATTT
TGCAGTCCAA AGCACGAGGC ATTCATGATC GGGACTACGA AGAATCCTAA TAATAAAGGA TTTGATCTTT TTATCACAAC
TGCTCCAATT CCTGACTTGA ATGACAAGCT TGTTGTATTT GGGCAAGTTA TCAATGGACA AGATATTGTT CAGGTACTTT
ACATTGAATT CTCTCTGGAT GCATTAATTC AGTTGCAGTT TCCATACATC ATTGGAACCT TTCATTTTTC ATTTATATTT
AATATCATTT TTCTAAAAAC AATATATTTC ATGCTGAGAT GTTCATGTCC TTACCTCATG ATTAGTATTG TTACATATTT
GTACATTATT TTGAGTTACA GTAGTGCTAA TGCCAATAGG AAATTGAAAG AGTTAGACAT GAGTTTAATA GGTGTGCTAA
TGGAGAGGAT ATGAGCTAAT TCAATGTCAT TATCTACAAA TGTATCAGAC GCATGTGCTT CAACTGGTTG AATTAGTATT
TTCTGAGTAT GTTCATTTTA ATGAGACTTT TTGCTTGTTT GATGACTTAA ACAGGAGATC GAAGAAGTTG ATACTGATGA
GCATTACCAG CCAAAAACCC CTATCGGCAT ACTCAACATC ACGCTAAAAC AGCAAGCTTT GAGCTGATAG CTTGTTGTCC
TTACCTGAAA ATGACTTATC TGTACTCCAA GAGGGTCCAT ACATCGCCTC CAATTGCTGC TGAAATTGAT TATGATTATG
GCTTCCTCTA GAAGCCCATG GGTTGCAAAG AAAGAAGGCG CTTAATCTTG CCTGGCAGCT AAAAGCTTCT TCCGTCTCAT
GGAGTAGTTG TGTATAAATT TATCCCTGGT GTCATTCGGC TGTCAGTTTT TGCAGGCATT ACAGTGTATT TTGATGCTTG
GTTGTTTCAT TGTAAATTTG AAGCCCATTT GGATCATGAA TCATAGAACT TGGAATTCAT AGTT

Locus: Os07g0476500

Loading...

Locus: Os07g0476500

Loading...