Os07t0476900-01

Locus

Os07g0476900

Description

Thioredoxin domain 2 containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

CDSP32

Oryzabase Gene Name Synonym(s)

Thioredoxin CDSP32, Trx CDSP32

Transcript Evidence

AK066045 (DDBJ, Best hit)

Protein Evidence

Q84NN4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: glycerol ether metabolic process (GO:0006662)

Biological Process: cell redox homeostasis (GO:0045454)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: protein disulfide oxidoreductase activity (GO:0015035)

Functional domain (InterPro)

Thioredoxin (IPR005746)

Thioredoxin-like fold (IPR012336)

Thioredoxin domain (IPR013766)

Full-length cDNA

J013049P20 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0476900-01)

RiceXPro (AK066045)

Others

Oryzabase (14055)

KEGG (Os07t0476900-01)

Transcript

1168 bp

>Os07t0476900-01 Thioredoxin domain 2 containing protein.
CTTTAATTCATCCTCTCTTCTCCTCTTCTCCTTCATCACTAGGCAGTAGCCACAGTAGCC
AGTAGCTAGCTAGCTTGTCAAGCTAGGAGCTAGCAGCTGTGTGTCGTCGATGGCATCCAC
CGCCGCCTTCCTGTCCACGCTCGCcggctcgaccagcctgggcggcgccacgccggccag
cggcggcgggagcgggaggagcaagacggcgaggttcttgaggaggcggcggcgcggcgg
cgcggtgagggcggcggtgtccggcacggagcaggcgccggagacgacgaagaagaaggg
cggcggcggcggcggcggggacgagcgggtggtgcaggtgcacagcgcggaggagctcga
cggcgcgctgcgggcggcgaaggagcggctggtggtggtggagttcgcggcgaGCCACAG
CGTGAACAGCAGCCGCATCTACCCGTGCATGGTGGAGCTGAGCCGCACCTGCGGCGACGT
CGACTTCCTCCTCGTCATGGGCGACGAGTCGGACGCCACCCGGGAGCTGTGCCGCCGGGA
GGGGATCACCGCCGTGCCCCACTTCACCTTCTACAAGGGCGCCGAGAAGGTCCACGAGGA
GGAGGGGATCGGCCCCGACCAGCTCGccggcgacgtcctctactacggcgaccaccactc
cgccgtcgtccagctccactcccgcgccgacgTCGAGTCCCTCATCTCCGACCACCGCGG
CGAGGGCGGCAAGCTGGTGGTGCTCGACGTGGGGCTCAAGCGATGCGGGCCCTGCGTGAA
GGTGTACCCCACCGTCGTGAAGCTGTCGCGCACCATGGCCGACACCACCGTCTTCGCCCG
CATGAACGGCGACGAGAACGACAGCTGCATGGAGTTCCTCCGCGACATGGACGTCGTCGA
GGTGCCCACCTTCCTCTTCATCAGGGACGGCGACATCGTCGGCCGCTACGTCGGCTCCGG
CAGGGGGGAGCTCATCGGCGAGATCCTCAGATACAACGGCGTCAAGGTCACCTAGACATA
TACAGATTCATCACTACGCAGCTCAGCTGCATGCAGCAACCGTAATTAAATTAATTACTG
TACTACTCTCTTGATCATGATTGTAATTTTACACCACCACACTAGCTTGAGAAGATCAAG
CTTGTTTTATACTGGGGACGATTTGATC

CDS

906 bp

>Os07t0476900-01 Thioredoxin domain 2 containing protein.
ATGGCATCCACCGCCGCCTTCCTGTCCACGCTCGCcggctcgaccagcctgggcggcgcc
acgccggccagcggcggcgggagcgggaggagcaagacggcgaggttcttgaggaggcgg
cggcgcggcggcgcggtgagggcggcggtgtccggcacggagcaggcgccggagacgacg
aagaagaagggcggcggcggcggcggcggggacgagcgggtggtgcaggtgcacagcgcg
gaggagctcgacggcgcgctgcgggcggcgaaggagcggctggtggtggtggagttcgcg
gcgaGCCACAGCGTGAACAGCAGCCGCATCTACCCGTGCATGGTGGAGCTGAGCCGCACC
TGCGGCGACGTCGACTTCCTCCTCGTCATGGGCGACGAGTCGGACGCCACCCGGGAGCTG
TGCCGCCGGGAGGGGATCACCGCCGTGCCCCACTTCACCTTCTACAAGGGCGCCGAGAAG
GTCCACGAGGAGGAGGGGATCGGCCCCGACCAGCTCGccggcgacgtcctctactacggc
gaccaccactccgccgtcgtccagctccactcccgcgccgacgTCGAGTCCCTCATCTCC
GACCACCGCGGCGAGGGCGGCAAGCTGGTGGTGCTCGACGTGGGGCTCAAGCGATGCGGG
CCCTGCGTGAAGGTGTACCCCACCGTCGTGAAGCTGTCGCGCACCATGGCCGACACCACC
GTCTTCGCCCGCATGAACGGCGACGAGAACGACAGCTGCATGGAGTTCCTCCGCGACATG
GACGTCGTCGAGGTGCCCACCTTCCTCTTCATCAGGGACGGCGACATCGTCGGCCGCTAC
GTCGGCTCCGGCAGGGGGGAGCTCATCGGCGAGATCCTCAGATACAACGGCGTCAAGGTC
ACCTAG

Protein

302 aa

>Os07t0476900-01 Thioredoxin domain 2 containing protein.
MASTAAFLSTLAGSTSLGGATPASGGGSGRSKTARFLRRRRRGGAVRAAVSGTEQAPETT
KKKGGGGGGGDERVVQVHSAEELDGALRAAKERLVVVEFAASHSVNSSRIYPCMVELSRT
CGDVDFLLVMGDESDATRELCRREGITAVPHFTFYKGAEKVHEEEGIGPDQLAGDVLYYG
DHHSAVVQLHSRADVESLISDHRGEGGKLVVLDVGLKRCGPCVKVYPTVVKLSRTMADTT
VFARMNGDENDSCMEFLRDMDVVEVPTFLFIRDGDIVGRYVGSGRGELIGEILRYNGVKV
T*

5'UTR

chr07:17268782..17268890 (+ strand) : 109 bp

CDS

chr07:17268891..17269796 (+ strand) : 906 bp

3'UTR

chr07:17269797..17269949 (+ strand) : 153 bp

FASTA

>Os07t0476900-01 class=Sequence position=chr07:17268782..17269949 (+ strand)
CTTTAATTCA TCCTCTCTTC TCCTCTTCTC CTTCATCACT AGGCAGTAGC CACAGTAGCC AGTAGCTAGC TAGCTTGTCA
AGCTAGGAGC TAGCAGCTGT GTGTCGTCGA TGGCATCCAC CGCCGCCTTC CTGTCCACGC TCGCcggctc gaccagcctg
ggcggcgcca cgccggccag cggcggcggg agcgggagga gcaagacggc gaggttcttg aggaggcggc ggcgcggcgg
cgcggtgagg gcggcggtgt ccggcacgga gcaggcgccg gagacgacga agaagaaggg cggcggcggc ggcggcgggg
acgagcgggt ggtgcaggtg cacagcgcgg aggagctcga cggcgcgctg cgggcggcga aggagcggct ggtggtggtg
gagttcgcgg cgaGCCACAG CGTGAACAGC AGCCGCATCT ACCCGTGCAT GGTGGAGCTG AGCCGCACCT GCGGCGACGT
CGACTTCCTC CTCGTCATGG GCGACGAGTC GGACGCCACC CGGGAGCTGT GCCGCCGGGA GGGGATCACC GCCGTGCCCC
ACTTCACCTT CTACAAGGGC GCCGAGAAGG TCCACGAGGA GGAGGGGATC GGCCCCGACC AGCTCGccgg cgacgtcctc
tactacggcg accaccactc cgccgtcgtc cagctccact cccgcgccga cgTCGAGTCC CTCATCTCCG ACCACCGCGG
CGAGGGCGGC AAGCTGGTGG TGCTCGACGT GGGGCTCAAG CGATGCGGGC CCTGCGTGAA GGTGTACCCC ACCGTCGTGA
AGCTGTCGCG CACCATGGCC GACACCACCG TCTTCGCCCG CATGAACGGC GACGAGAACG ACAGCTGCAT GGAGTTCCTC
CGCGACATGG ACGTCGTCGA GGTGCCCACC TTCCTCTTCA TCAGGGACGG CGACATCGTC GGCCGCTACG TCGGCTCCGG
CAGGGGGGAG CTCATCGGCG AGATCCTCAG ATACAACGGC GTCAAGGTCA CCTAGACATA TACAGATTCA TCACTACGCA
GCTCAGCTGC ATGCAGCAAC CGTAATTAAA TTAATTACTG TACTACTCTC TTGATCATGA TTGTAATTTT ACACCACCAC
ACTAGCTTGA GAAGATCAAG CTTGTTTTAT ACTGGGGACG ATTTGATC

Locus: Os07g0476900

Loading...

Locus: Os07g0476900

Loading...