Os07t0479100-01

Locus

Os07g0479100

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRFPH2-17

Oryzabase Gene Name Synonym(s)

RING finger protein OsRFPH2-17, RING-H2 protein 17

Transcript Evidence

AK103576 (DDBJ, Best hit)

Protein Evidence

NP_001150850.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-H2-type (IPR024766)

Full-length cDNA

J033132P09 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0479100-01)

RiceXPro (AK103576)

Others

Oryzabase (11778)

KEGG (Os07t0479100-01)

Transcript

1035 bp

>Os07t0479100-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
TTGCGCACCCACAGTGGTTGTTTTCTTGGATGGTTGCCGCTGCGCCCTGACCTCACCTCC
CTCTCCCCCATGGATTACTCCGCCATGCCTTCTCCTTCTCCTTCTTCTTCTGCCGCTGCG
GCGGCGGCGGCGGCGTCGGGGTGCTGCCTCGACAGGCTGTGGAGGGCGTGCGGGGGCTGC
GGCGCCGCCGCCGCCTCCGCCGCCGGGTGGACGGTCTGCGCGCTGCTCACCTGCGTCTTC
GCCGTCGTGGGCTCATTAGTTGGAGTCTTCATCGGCGCGTTCATGGGGATGTCCACGGAA
AGCGGCATGCTACGAGGCGCAGGCGTCGGGGTGGTCTCCGGCGCGGTCTTCTCCATCGAG
GCCGTCGAATCGTGCATCGAAATCTGGAGATCAAGTGAATCAGGAAAATACAGCATTATC
TTCGTGCTTGACATCATCTCTAGCCTCTTCAGTGGAAGGATTGTGTGGGAGAAGGTCAGC
CCAGCACTGCAGCGCGCGGTGCAGAGTCAGATGAGTCTACTGAGTACACCATTCATTGAC
AACAATGACCTTTTTGAAACCGGAAATACAGGAGGCATGTCAAGAGATCTAATTAACAGA
ATCCCAAAGACCACATTCAGCGCTGCAACCAATCCTGATCAGGAAACTGATAACTGTTGT
GCAGTTTGCCTTCAGGATTTTGGAGCATCGCAATTTGTTCGGGTCCTGCCTCATTGCCAG
CACACGTTCCACGCACGATGCATCGACAACTGGCTTTTCAGGCACGCATCATGCCCGCTA
TGCAGGGCTGGTGTGCATATAGACCATATACATATGTAAAATAGAACTCGCAGCGCACCT
GGTGTATTTTCAGGCGAATACCCGTGCCCGCGGTCCGTATCATAAGTATAGTCTTGTACA
CATAGGAGGCCTTTTTTTCTTCCCAGTCTTTGTGTGGAGCTATGTTCCAGCCGCACGTTT
TTTTGTTACAGCAATAACAAGTTATGTACTAATATACATTCTGAAAAAAAGAACTAAACT
AACAGTCTCTGAATT

CDS

750 bp

>Os07t0479100-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATGGATTACTCCGCCATGCCTTCTCCTTCTCCTTCTTCTTCTGCCGCTGCGGCGGCGGCG
GCGGCGTCGGGGTGCTGCCTCGACAGGCTGTGGAGGGCGTGCGGGGGCTGCGGCGCCGCC
GCCGCCTCCGCCGCCGGGTGGACGGTCTGCGCGCTGCTCACCTGCGTCTTCGCCGTCGTG
GGCTCATTAGTTGGAGTCTTCATCGGCGCGTTCATGGGGATGTCCACGGAAAGCGGCATG
CTACGAGGCGCAGGCGTCGGGGTGGTCTCCGGCGCGGTCTTCTCCATCGAGGCCGTCGAA
TCGTGCATCGAAATCTGGAGATCAAGTGAATCAGGAAAATACAGCATTATCTTCGTGCTT
GACATCATCTCTAGCCTCTTCAGTGGAAGGATTGTGTGGGAGAAGGTCAGCCCAGCACTG
CAGCGCGCGGTGCAGAGTCAGATGAGTCTACTGAGTACACCATTCATTGACAACAATGAC
CTTTTTGAAACCGGAAATACAGGAGGCATGTCAAGAGATCTAATTAACAGAATCCCAAAG
ACCACATTCAGCGCTGCAACCAATCCTGATCAGGAAACTGATAACTGTTGTGCAGTTTGC
CTTCAGGATTTTGGAGCATCGCAATTTGTTCGGGTCCTGCCTCATTGCCAGCACACGTTC
CACGCACGATGCATCGACAACTGGCTTTTCAGGCACGCATCATGCCCGCTATGCAGGGCT
GGTGTGCATATAGACCATATACATATGTAA

Protein

250 aa

>Os07t0479100-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
MDYSAMPSPSPSSSAAAAAAAASGCCLDRLWRACGGCGAAAASAAGWTVCALLTCVFAVV
GSLVGVFIGAFMGMSTESGMLRGAGVGVVSGAVFSIEAVESCIEIWRSSESGKYSIIFVL
DIISSLFSGRIVWEKVSPALQRAVQSQMSLLSTPFIDNNDLFETGNTGGMSRDLINRIPK
TTFSAATNPDQETDNCCAVCLQDFGASQFVRVLPHCQHTFHARCIDNWLFRHASCPLCRA
GVHIDHIHM*

5'UTR

chr07:17400026..17400094 (+ strand) : 69 bp

CDS

chr07:17400095..17400272 (+ strand) : 178 bp

chr07:17400925..17401103 (+ strand) : 179 bp

chr07:17401439..17401522 (+ strand) : 84 bp

chr07:17402419..17402583 (+ strand) : 165 bp

chr07:17402674..17402817 (+ strand) : 144 bp

3'UTR

chr07:17402818..17403033 (+ strand) : 216 bp

FASTA

>Os07t0479100-01 class=Sequence position=chr07:17400026..17403033 (+ strand)
TTGCGCACCC ACAGTGGTTG TTTTCTTGGA TGGTTGCCGC TGCGCCCTGA CCTCACCTCC CTCTCCCCCA TGGATTACTC
CGCCATGCCT TCTCCTTCTC CTTCTTCTTC TGCCGCTGCG GCGGCGGCGG CGGCGTCGGG GTGCTGCCTC GACAGGCTGT
GGAGGGCGTG CGGGGGCTGC GGCGCCGCCG CCGCCTCCGC CGCCGGGTGG ACGGTCTGCG CGCTGCTCAC CTGCGTCTTC
GCCGTCGGTA CATCCCCCTC TCTCGCCCGC GGCCTCCTCC TTCCCATTGC TTGTCGCGCG AGTGCAATCT TGGGGTGGGG
TGATTTTTAT TTGATTTTTT AGATGTTTGC CTCCTCGGAT TCTTGCTTCA TGGGAGTCTA TTGGTCCTAC TAAGTTCTTG
GATTGATTCG GTGGGTGGTG TGTTCCTGGA ATATGTTGTG ATTCATGGTG GGAATTAATC GAATCACCAT AGGTTCTGTT
CACTCTTGCC GCCCTCGGAG ACTCTGTAGT TGATAGTGTG TTCTTTGGCT CTCCTTGCTT TACGACTTTT ACACGTTGTG
GTGTGGTAGG CTGCTGCTTG CTCAAATTGG GAACAATTCA ATCCCGCAAG CAAAAATTTT GGAGGTTCTT TGCCACTTCC
GTCTCAGGAT TTAGTATATA CTTCACTCAG ACGCTTCTAC CTTTTTCTTT TATTCCCCCC TTTCTTCTCT AGGTTTTATG
GGCTTCATGG TTCATCAGTT TCTTCTATTT TGTTTGTTCC ATTGTTTTTG TATCTTTCCT TCTTGCAAGT TTTAGTTCAC
AGAATTTTTG GGTTTTCCAA TAAAGAGTAG GTGCATATTA GTCAGCAATT TTTTTATGAA AGCTCTCATT GGTGTTTTCA
TCTCTTCTGT TGAATGCAGT GGGCTCATTA GTTGGAGTCT TCATCGGCGC GTTCATGGGG ATGTCCACGG AAAGCGGCAT
GCTACGAGGC GCAGGCGTCG GGGTGGTCTC CGGCGCGGTC TTCTCCATCG AGGCCGTCGA ATCGTGCATC GAAATCTGGA
GATCAAGTGA ATCAGGAAAA TACAGCATTA TCTTCGTGGT GAGTGTGCAA GAATCCAAGA CCCAACCTTC CCTTTTTACT
TTTGTGTGTT GAGAAAGGTG AGAGATCATT TTCACACAAC TACTCTAGCG TGTGCATACA TCACTTTGAT GTAAGCTTGA
CATTTGCATG TGAGAAAAAT ATGTGCTTTA CTACTAATAA TTGCCGAGAA ATGAAGAAAG CAAGGAAATT TTACTCGTAA
GTCGTAAAGC AAATGTTTTG GACTTTATTA TCTATAGTAT GTCACAATTT CTTGTGTGCG CAAATACAAT AGCAGCAGGT
GATGAGTGTA GTTGATTTTT ATTTGCTCTG ATGTACTCTG TCGGTTGTTT CAGCTTGACA TCATCTCTAG CCTCTTCAGT
GGAAGGATTG TGTGGGAGAA GGTCAGCCCA GCACTGCAGC GCGCGGTGCA GAGTCAGGTA TGCAGCTCTT CCTTTGAGCT
TTCATAATGT TCGATCGAGT AAGAAACCAT TACTCTCTTA TGGCTCAAAT AATAGTTTGC ACTGCTAGCT ATTTCAGTTT
TTAGGGGGTT AGATGGTTTT AATGTATGAA AAGAAAATAT TTTTAAGTAT GGAAATGATT TTAGGGGAGA ATGATGCCCC
ATACTGCAAC AGGAAGACCT CTATAGCAAC TAGAATATCA AGAATAGCAT TTTAATGCTA AAGACATCAA CCCCTAGAGA
CATCTAATGG CTTCCTGTGG ACATGTGACA GAAAGCATTA CTCCATCCCA TATATAATGT ATGGATGGTC AAGTAGTACT
TGGGAACACT GAGAGTACAA CTAATATAGG GTTGTGTAAC CTGGCCTGGT AGGAACCTTG TTAAAAGCGT TCGGAATTTT
GAAACTGAAT TATCCAATAA AGGTAACAAG ACACGGAACC ATAACTTAAA ACATATATTA AAAGGTGTTA TGCATGAATT
TTAATGCTGT AAGTAAGTAT GGTGTAATTT TTTAAAAAAA AAATGAAAAC AAAAAACTTA ATACATATAC TATTTCCGTC
CATAAAAGAG CGTATTTTTT GCTATGAACC TGGATTTATG AATGAATACA ACCTCCCAAC ATCCAAGGCC TACACATAAG
GTTTTTTTTT ATTGGACCAG GTGGTGTTTC CTTCTGTCCA CATACCCTTG TCAGATTTTA TAGGGCAGGA TATTTATCCA
TTATATGCAA AACTCAATTG CCGGAAGCAA CAACTTTTTA GGCATGATAA GCATATAATT GCATTTCGTT GATTTAACTT
TGCAAGGTTC TATGCGATTG CAACAGGGTC TATGTATAAT TCTAAGTCTG ATTCATTATT CTCTCTAATG CAGATGAGTC
TACTGAGTAC ACCATTCATT GACAACAATG ACCTTTTTGA AACCGGAAAT ACAGGAGGCA TGTCAAGAGA TCTAATTAAC
AGAATCCCAA AGACCACATT CAGCGCTGCA ACCAATCCTG ATCAGGAAAC TGATAACTGT TGTGCAGTTT GCCTTCAGGT
TAGTGTGAAC CTAGAATGCT GCATTCTAAC CACAGATGCT AAACAGATTA GTTTCTTGTA CTGACGCACC ATAACTTCTG
ATTGCCAGGA TTTTGGAGCA TCGCAATTTG TTCGGGTCCT GCCTCATTGC CAGCACACGT TCCACGCACG ATGCATCGAC
AACTGGCTTT TCAGGCACGC ATCATGCCCG CTATGCAGGG CTGGTGTGCA TATAGACCAT ATACATATGT AAAATAGAAC
TCGCAGCGCA CCTGGTGTAT TTTCAGGCGA ATACCCGTGC CCGCGGTCCG TATCATAAGT ATAGTCTTGT ACACATAGGA
GGCCTTTTTT TCTTCCCAGT CTTTGTGTGG AGCTATGTTC CAGCCGCACG TTTTTTTGTT ACAGCAATAA CAAGTTATGT
ACTAATATAC ATTCTGAAAA AAAGAACTAA ACTAACAGTC TCTGAATT

Locus: Os07g0479100

Loading...

Locus: Os07g0479100

Loading...