Os07t0479100-02

Locus

Os07g0479100

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRFPH2-17

Oryzabase Gene Name Synonym(s)

RING finger protein OsRFPH2-17, RING-H2 protein 17

Transcript Evidence

AK069812 (DDBJ, Best hit)

Protein Evidence

NP_001150850.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-H2-type (IPR024766)

Full-length cDNA

J023031G24 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0479100-02)

RiceXPro (AK069812)

Others

Oryzabase (11778)

KEGG (Os07t0479100-02)

Transcript

1017 bp

>Os07t0479100-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATTCCCCCCTTTCTTCTCTAGGTTTTATGGGCTTCATGGTTCATCAGTTTCTTCTATTTT
GTTTGTTCCATTGTTTTTGTATCTTTCCTTCTTGCAAGTTTTAGTTCACAGAATTTTTGG
GTTTTCCAATAAAGAGTAGGTGCATATTAGTCAGCAATTTTTTTATGAAAGCTCTCATTG
GTGTTTTCATCTCTTCTGTTGAATGCAGTGGGCTCATTAGTTGGAGTCTTCATCGGCGCG
TTCATGGGGATGTCCACGGAAAGCGGCATGCTACGAGGCGCAGGCGTCGGGGTGGTCTCC
GGCGCGGTCTTCTCCATCGAGGCCGTCGAATCGTGCATCGAAATCTGGAGATCAAGTGAA
TCAGGAAAATACAGCATTATCTTCGTGCTTGACATCATCTCTAGCCTCTTCAGTGGAAGG
ATTGTGTGGGAGAAGGTCAGCCCAGCACTGCAGCGCGCGGTGCAGAGTCAGATGAGTCTA
CTGAGTACACCATTCATTGACAACAATGACCTTTTTGAAACCGGAAATACAGGAGGCATG
TCAAGAGATCTAATTAACAGAATCCCAAAGACCACATTCAGCGCTGCAACCAATCCTGAT
CAGGAAACTGATAACTGTTGTGCAGTTTGCCTTCAGGATTTTGGAGCATCGCAATTTGTT
CGGGTCCTGCCTCATTGCCAGCACACGTTCCACGCACGATGCATCGACAACTGGCTTTTC
AGGCACGCATCATGCCCGCTATGCAGGGCTGGTGTGCATATAGACCATATACATATGTAA
AATAGAACTCGCAGCGCACCTGGTGTATTTTCAGGCGAATACCCGTGCCCGCGGTCCGTA
TCATAAGTATAGTCTTGTACACATAGGAGGCCTTTTTTTCTTCCCAGTCTTTGTGTGGAG
CTATGTTCCAGCCGCACGTTTTTTTGTTACAGCAATAACAAGTTATGTACTAATATACAT
TCTGAAAAAAAGAACTAAACTAACAGTCTCTGAATTATGGCTGTGTACTGGAGCCTC

CDS

612 bp

>Os07t0479100-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
AAGCTCTCATTGGTGTTTTCATCTCTTCTGTTGAATGCAGTGGGCTCATTAGTTGGAGTC
TTCATCGGCGCGTTCATGGGGATGTCCACGGAAAGCGGCATGCTACGAGGCGCAGGCGTC
GGGGTGGTCTCCGGCGCGGTCTTCTCCATCGAGGCCGTCGAATCGTGCATCGAAATCTGG
AGATCAAGTGAATCAGGAAAATACAGCATTATCTTCGTGCTTGACATCATCTCTAGCCTC
TTCAGTGGAAGGATTGTGTGGGAGAAGGTCAGCCCAGCACTGCAGCGCGCGGTGCAGAGT
CAGATGAGTCTACTGAGTACACCATTCATTGACAACAATGACCTTTTTGAAACCGGAAAT
ACAGGAGGCATGTCAAGAGATCTAATTAACAGAATCCCAAAGACCACATTCAGCGCTGCA
ACCAATCCTGATCAGGAAACTGATAACTGTTGTGCAGTTTGCCTTCAGGATTTTGGAGCA
TCGCAATTTGTTCGGGTCCTGCCTCATTGCCAGCACACGTTCCACGCACGATGCATCGAC
AACTGGCTTTTCAGGCACGCATCATGCCCGCTATGCAGGGCTGGTGTGCATATAGACCAT
ATACATATGTAA

Protein

204 aa

>Os07t0479100-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
KLSLVFSSLLLNAVGSLVGVFIGAFMGMSTESGMLRGAGVGVVSGAVFSIEAVESCIEIW
RSSESGKYSIIFVLDIISSLFSGRIVWEKVSPALQRAVQSQMSLLSTPFIDNNDLFETGN
TGGMSRDLINRIPKTTFSAATNPDQETDNCCAVCLQDFGASQFVRVLPHCQHTFHARCID
NWLFRHASCPLCRAGVHIDHIHM*

5'UTR

chr07:17400717..17400884 (+ strand) : 168 bp

CDS

chr07:17400885..17401103 (+ strand) : 219 bp

chr07:17401439..17401522 (+ strand) : 84 bp

chr07:17402419..17402583 (+ strand) : 165 bp

chr07:17402674..17402817 (+ strand) : 144 bp

3'UTR

chr07:17402818..17403054 (+ strand) : 237 bp

FASTA

>Os07t0479100-02 class=Sequence position=chr07:17400717..17403054 (+ strand)
ATTCCCCCCT TTCTTCTCTA GGTTTTATGG GCTTCATGGT TCATCAGTTT CTTCTATTTT GTTTGTTCCA TTGTTTTTGT
ATCTTTCCTT CTTGCAAGTT TTAGTTCACA GAATTTTTGG GTTTTCCAAT AAAGAGTAGG TGCATATTAG TCAGCAATTT
TTTTATGAAA GCTCTCATTG GTGTTTTCAT CTCTTCTGTT GAATGCAGTG GGCTCATTAG TTGGAGTCTT CATCGGCGCG
TTCATGGGGA TGTCCACGGA AAGCGGCATG CTACGAGGCG CAGGCGTCGG GGTGGTCTCC GGCGCGGTCT TCTCCATCGA
GGCCGTCGAA TCGTGCATCG AAATCTGGAG ATCAAGTGAA TCAGGAAAAT ACAGCATTAT CTTCGTGGTG AGTGTGCAAG
AATCCAAGAC CCAACCTTCC CTTTTTACTT TTGTGTGTTG AGAAAGGTGA GAGATCATTT TCACACAACT ACTCTAGCGT
GTGCATACAT CACTTTGATG TAAGCTTGAC ATTTGCATGT GAGAAAAATA TGTGCTTTAC TACTAATAAT TGCCGAGAAA
TGAAGAAAGC AAGGAAATTT TACTCGTAAG TCGTAAAGCA AATGTTTTGG ACTTTATTAT CTATAGTATG TCACAATTTC
TTGTGTGCGC AAATACAATA GCAGCAGGTG ATGAGTGTAG TTGATTTTTA TTTGCTCTGA TGTACTCTGT CGGTTGTTTC
AGCTTGACAT CATCTCTAGC CTCTTCAGTG GAAGGATTGT GTGGGAGAAG GTCAGCCCAG CACTGCAGCG CGCGGTGCAG
AGTCAGGTAT GCAGCTCTTC CTTTGAGCTT TCATAATGTT CGATCGAGTA AGAAACCATT ACTCTCTTAT GGCTCAAATA
ATAGTTTGCA CTGCTAGCTA TTTCAGTTTT TAGGGGGTTA GATGGTTTTA ATGTATGAAA AGAAAATATT TTTAAGTATG
GAAATGATTT TAGGGGAGAA TGATGCCCCA TACTGCAACA GGAAGACCTC TATAGCAACT AGAATATCAA GAATAGCATT
TTAATGCTAA AGACATCAAC CCCTAGAGAC ATCTAATGGC TTCCTGTGGA CATGTGACAG AAAGCATTAC TCCATCCCAT
ATATAATGTA TGGATGGTCA AGTAGTACTT GGGAACACTG AGAGTACAAC TAATATAGGG TTGTGTAACC TGGCCTGGTA
GGAACCTTGT TAAAAGCGTT CGGAATTTTG AAACTGAATT ATCCAATAAA GGTAACAAGA CACGGAACCA TAACTTAAAA
CATATATTAA AAGGTGTTAT GCATGAATTT TAATGCTGTA AGTAAGTATG GTGTAATTTT TTAAAAAAAA AATGAAAACA
AAAAACTTAA TACATATACT ATTTCCGTCC ATAAAAGAGC GTATTTTTTG CTATGAACCT GGATTTATGA ATGAATACAA
CCTCCCAACA TCCAAGGCCT ACACATAAGG TTTTTTTTTA TTGGACCAGG TGGTGTTTCC TTCTGTCCAC ATACCCTTGT
CAGATTTTAT AGGGCAGGAT ATTTATCCAT TATATGCAAA ACTCAATTGC CGGAAGCAAC AACTTTTTAG GCATGATAAG
CATATAATTG CATTTCGTTG ATTTAACTTT GCAAGGTTCT ATGCGATTGC AACAGGGTCT ATGTATAATT CTAAGTCTGA
TTCATTATTC TCTCTAATGC AGATGAGTCT ACTGAGTACA CCATTCATTG ACAACAATGA CCTTTTTGAA ACCGGAAATA
CAGGAGGCAT GTCAAGAGAT CTAATTAACA GAATCCCAAA GACCACATTC AGCGCTGCAA CCAATCCTGA TCAGGAAACT
GATAACTGTT GTGCAGTTTG CCTTCAGGTT AGTGTGAACC TAGAATGCTG CATTCTAACC ACAGATGCTA AACAGATTAG
TTTCTTGTAC TGACGCACCA TAACTTCTGA TTGCCAGGAT TTTGGAGCAT CGCAATTTGT TCGGGTCCTG CCTCATTGCC
AGCACACGTT CCACGCACGA TGCATCGACA ACTGGCTTTT CAGGCACGCA TCATGCCCGC TATGCAGGGC TGGTGTGCAT
ATAGACCATA TACATATGTA AAATAGAACT CGCAGCGCAC CTGGTGTATT TTCAGGCGAA TACCCGTGCC CGCGGTCCGT
ATCATAAGTA TAGTCTTGTA CACATAGGAG GCCTTTTTTT CTTCCCAGTC TTTGTGTGGA GCTATGTTCC AGCCGCACGT
TTTTTTGTTA CAGCAATAAC AAGTTATGTA CTAATATACA TTCTGAAAAA AAGAACTAAA CTAACAGTCT CTGAATTATG
GCTGTGTACT GGAGCCTC

Locus: Os07g0479100

Loading...

Locus: Os07g0479100

Loading...