Os07t0492000-01

Locus

Os07g0492000

Description

Nucleoside diphosphate kinase, Cell elongation process in coleoptile

RAP-DB Gene Symbol Synonym(s)

OsNDPK1

RAP-DB Gene Name Synonym(s)

NUCLEOSIDE DIPHOSPHATE KINASE 1, Nucleoside diphosphate kinase 1

CGSNL Gene Symbol

CGSNL Gene Name

NUCLEOSIDE DIPHOSPHATE KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsNDPK1, NDK, rNDK, NDK1, NDKR, NDK-1

Oryzabase Gene Name Synonym(s)

nucleoside diphosphate kinase 1, Nucleoside diphosphate kinase, 16.8 kDa NDK, NDP kinase

Transcript Evidence

AK121796

D16292

Protein Evidence

Q07661

Literature

PMID: 21897044

PMID: 10677437

PMID: 8260630

Note

Manual Curation

May 24, 2017

Gene Ontology (GO)

Biological Process: nucleoside diphosphate phosphorylation (GO:0006165)

Biological Process: GTP biosynthetic process (GO:0006183)

Biological Process: UTP biosynthetic process (GO:0006228)

Biological Process: CTP biosynthetic process (GO:0006241)

Molecular Function: nucleoside diphosphate kinase activity (GO:0004550)

Functional domain (InterPro)

Nucleoside diphosphate kinase (IPR001564)

Nucleoside diphosphate kinase-like domain (IPR034907)

Nucleoside diphosphate kinase, active site (IPR023005)

Experimentally confirmed subcellular location

cytosol (GO:0005829)

Full-length cDNA

J033095O19 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0492000-01)

RiceXPro (AK121796)

Others

Oryzabase (9876)

KEGG (Os07t0492000-01 (EC:2.7.4.6))

Transcript

865 bp

>Os07t0492000-01 Nucleoside diphosphate kinase, Cell elongation process in coleoptile
ACTCCGCCTCGCCTCCACTCCTCTCCTCTCCGCATCCTCCTCATCGCCTCCGCTTCTGCT
TTTTTTTTTCTTTTTTCTCGTTGATCGGTTTGTTCGATCAGATCGGTTCTTTGGAGAGAT
GGAGCAGTCCTTCATCATGATCAAGCCTGACGGCGTCCAGAGAGGCCTGATTGGAGACAT
CATCAGCAGGTTCGAGAAGAAAGGATTCTACCTGAGGGGGATGAAGTTCATGAATGTGGA
GAGGTCCTTTGCACAGCAGCACTATGCCGACCTTTCCGACAAGCCCTTCTTCCCTGGGTT
GGTGGAGTACATCATCTCTGGCCCCGTCGTTGCGATGGTTTGGGAAGGGAAGGATGTTGT
TGCCACTGGCCGCAGGATCATTGGGGCCACCAGGCCCTGGGAGGCAGCCCCCGGCACCAT
CCGTGCTGACTATGCCGTGGAAGTTGGCAGGAATGTCATCCATGGGAGCGACTCCGTGGA
CAACGGGAAGAAGGAGATCGCTCTCTGGTTCCCTGAAGGTTTAGCTGAGTGGAGGAGCAA
CCTTCACCCTTGGATCTATGAGTCTTAGAGCTTCGCGCCTATAATCGATCACCTCTTGGT
GGCTAGTTCTCGTTAAATATTTGAGTTTTGTTTCAGAGTTGTCATCTGGCTGCCTCCTGA
GTCACCATTATAATTCTGCTGTGATACAATCACAGTTATATGTTGCCTGAACTTATATGG
CTTTTTAAGTTTCTGGATTGGATGTGATGGGAAAATAATACTAGCAGTCAGTTTTTGCTT
ATAAATGTCGTAATATCTTAATCATGCTCTTTCCCTAGGTTCATCCAAGATAAGCAGATG
GTGTTGCCTGATTTTCTTGTGGCAC

CDS

450 bp

>Os07t0492000-01 Nucleoside diphosphate kinase, Cell elongation process in coleoptile
ATGGAGCAGTCCTTCATCATGATCAAGCCTGACGGCGTCCAGAGAGGCCTGATTGGAGAC
ATCATCAGCAGGTTCGAGAAGAAAGGATTCTACCTGAGGGGGATGAAGTTCATGAATGTG
GAGAGGTCCTTTGCACAGCAGCACTATGCCGACCTTTCCGACAAGCCCTTCTTCCCTGGG
TTGGTGGAGTACATCATCTCTGGCCCCGTCGTTGCGATGGTTTGGGAAGGGAAGGATGTT
GTTGCCACTGGCCGCAGGATCATTGGGGCCACCAGGCCCTGGGAGGCAGCCCCCGGCACC
ATCCGTGCTGACTATGCCGTGGAAGTTGGCAGGAATGTCATCCATGGGAGCGACTCCGTG
GACAACGGGAAGAAGGAGATCGCTCTCTGGTTCCCTGAAGGTTTAGCTGAGTGGAGGAGC
AACCTTCACCCTTGGATCTATGAGTCTTAG

Protein

150 aa

>Os07t0492000-01 Nucleoside diphosphate kinase, Cell elongation process in coleoptile
MEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSFAQQHYADLSDKPFFPG
LVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIRADYAVEVGRNVIHGSDSV
DNGKKEIALWFPEGLAEWRSNLHPWIYES*

5'UTR

chr07:18337363..18337480 (- strand) : 118 bp

CDS

chr07:18337312..18337362 (- strand) : 51 bp

chr07:18337065..18337113 (- strand) : 49 bp

chr07:18335853..18336084 (- strand) : 232 bp

chr07:18335294..18335411 (- strand) : 118 bp

3'UTR

chr07:18334997..18335293 (- strand) : 297 bp

FASTA

>Os07t0492000-01 class=Sequence position=chr07:18334997..18337480 (- strand)
ACTCCGCCTC GCCTCCACTC CTCTCCTCTC CGCATCCTCC TCATCGCCTC CGCTTCTGCT TTTTTTTTTC TTTTTTCTCG
TTGATCGGTT TGTTCGATCA GATCGGTTCT TTGGAGAGAT GGAGCAGTCC TTCATCATGA TCAAGCCTGA CGGCGTCCAG
AGAGGCCTGG TAATCTGACT TCTTTTTTTC TTTTAATGTT CTTCTTGTCG TTTTGGCCAT CGATTTTCGA GAGGAATTTT
GCGGTTTCGG ATCGGTTAAA TAGCGTAGTT GATTGGTGTT TGTTTGTGAG ATTTTGAGTT GTTTTGGTAA CTTTTTGTAC
CGTTTTGCGT GGTTTTTAAT GGGGAATTTT GATTTTCTGT TCTGCAGATT GGAGACATCA TCAGCAGGTT CGAGAAGAAA
GGATTCTACC TGAGGGGTAT GGCTGATCCT TTTCCCCTCT CGATTTGATC GTATGGATTC ATTTTTCATA ACTTTCTTTT
GTATTTTTAT TGATCTAATT TTGGGTTGAC CTACCCGTTT TTTTCAACAC ATATTATGAA AAGCAGAGGC TGACGATATC
ATAATACTCT GTTTCATATG GGTAGGTTGG GGTTGTGAGT TGTGACATGG AGAATTTGAT GGGTTTAATA CATGATTCAA
AAGCAAGATT TTTTTATATA ATTTATATGT TGATGATTGG CCATTTTTAA CTGGGGACAA CAGACTGACA CAGTAATATT
CAATTTAGTA TATCAACTGA TTCGTTGTCA AGTCTAATTT TGCATTACAT GACATGGGCA ACTTATTTAT TATTATAGCA
GAGATCGTCA AAGCCTCAAA GATGTAGTCT ACTATTTGTA CTTGTAATCA TGGAAATATC TTTCTGAAAA GAAAACATCA
TTTGTACTTG CAATAGAGTT CAACTAATAT CTTTGGCATG CATTTAACGT GCTCTTTTCC ATTTTTTGTT CCTTATTAAA
AGTTGTTGTA CTTTAGTGGA AACCAAAATG TTTTATAAAG CATTACAGAA CAACAAAAAC AGCTGTCTTA AGGAACAGCA
ACAAAGAACA GAAGTAAAGG ACTTTCATTT AACTTCCCCT GTTTATAACA ACTGTGTAGC CATGTATTGG TTGATGTGGC
GATTATAACA ACTGTGAAGC CCATTTTTAT GAGAATTATT CGAAATGCAC GCAAAACATC ATCCAAAAAC TTAATTTCAT
TTAACTTCCC CTGTTTAAGA AATAtacttc ctccattcca aactataagc atttatgcgt gttattcaca atgaatctcg
atcttgagat tcattctgaa aaacaagtat aaatgCTTTT TATTTTGGAA CGGAGGTAAT ATTCGGTTGA GGGATGATGG
TGCTTACGAA TTACTTTTTG AACTGCAATG ATCCAGGGAT GAAGTTCATG AATGTGGAGA GGTCCTTTGC ACAGCAGCAC
TATGCCGACC TTTCCGACAA GCCCTTCTTC CCTGGGTTGG TGGAGTACAT CATCTCTGGC CCCGTCGTTG CGATGGTTTG
GGAAGGGAAG GATGTTGTTG CCACTGGCCG CAGGATCATT GGGGCCACCA GGCCCTGGGA GGCAGCCCCC GGCACCATCC
GTGCTGACTA TGCCGTGGAA GTTGGCAGGT GAGTCATTCT TGTCTGTCTT GGTCATCAGC TCATTATTGC TTGAATTTTC
AGTCAGTTCT TGTGATCCTT TTAATCATGT AAGGATCCTG AGCGATGGAT GGTTCTTTAT TTGTTTTGCT GCTAGCATCA
AACGATGATT TTGTTTGAAA ATGGGTGGTT AAGTGGCTTT TATTTTGATC TATATAAATG TGTGAACCTC TGTTTTTTAC
CAGTCAGAAG GTATCAGATA GTGAATGTGC TGTGATATGA TTTACAAAAA CTTTTGCATG CATTATGATG TTCATCTTTT
CTATATGTTA CGATGTTAGT GTATTTAGAC ATAATAACTA CTTGGATTAT GTTAAACTAT GTTCAATTCT AGCTTTTGTT
TTTGAAAATA AAAATCATAA TGCTTCCTGC TTATCGATGC CTAAGCTCAA GCTGTTGTTT CTTGTGTAGG AATGTCATCC
ATGGGAGCGA CTCCGTGGAC AACGGGAAGA AGGAGATCGC TCTCTGGTTC CCTGAAGGTT TAGCTGAGTG GAGGAGCAAC
CTTCACCCTT GGATCTATGA GTCTTAGAGC TTCGCGCCTA TAATCGATCA CCTCTTGGTG GCTAGTTCTC GTTAAATATT
TGAGTTTTGT TTCAGAGTTG TCATCTGGCT GCCTCCTGAG TCACCATTAT AATTCTGCTG TGATACAATC ACAGTTATAT
GTTGCCTGAA CTTATATGGC TTTTTAAGTT TCTGGATTGG ATGTGATGGG AAAATAATAC TAGCAGTCAG TTTTTGCTTA
TAAATGTCGT AATATCTTAA TCATGCTCTT TCCCTAGGTT CATCCAAGAT AAGCAGATGG TGTTGCCTGA TTTTCTTGTG
GCAC

Locus: Os07g0492000

Loading...

Locus: Os07g0492000

Loading...