Os07t0508500-01

Locus

Os07g0508500

Description

Ser/Thr kinase, Generation of proper tension between homologous kinetochores

RAP-DB Gene Symbol Synonym(s)

BRK1

RAP-DB Gene Name Synonym(s)

Bub1-related kinase 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

BRK1

Oryzabase Gene Name Synonym(s)

Bub1-related kinase 1

Transcript Evidence

JQ990990 (Zhongxian 3037)

Protein Evidence

I6UFZ9

Literature

PMID: 23243128

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 19, 2014

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Mitotic checkpoint serine/threonine protein kinase Bub1/Mitotic spindle checkpoint component Mad3 (IPR015661)

Mad3/BUB1 homology region 1 (IPR013212)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Expression Databases

TENOR (Os07t0508500-01)

Others

Oryzabase (12255)

Transcript

2066 bp

>Os07t0508500-01 Ser/Thr kinase, Generation of proper tension between homologous kinetochores
CCCAAGCGATCCGCATCCCAAACCATTCGAAATTCAAATTATTCCCCTCTTCCGCTCCAT
CTCCTTCCCGTCTTTCTCTCTCCACACAGACAGCGCACGCATCCACCACCCCCCAACACG
GGAGCGGAGAGCTCGCCGCCGGCGATCGCCGCAGGATTCTGAGGGCTTCTTCCGGCGGCC
ACGGGAGATGGTTCTGCTCGAACGCACGCCGTTGGTGGTGCCCGAGGCAGCAGCAGCAGC
CGCCGCCGCCTCCAGCCCGCTCCGGAGGCCGTCGCCTAGGGTTCTGAGGGAGGTGCCCCC
GCCCCCCCTCGATCCCATCCTCCCCTACCTCAGGTCTATCAACAAGGCTATGGATGAGCT
CAGGACAGGCCCAAAATTTGAAGCAGCAGCGCTTGATCGGCTCAAGATTTGTGTAATGGA
ATGCATTGATAAGTATGGTGACGATTACCAGTACTCCACAGACCCCCGACTCCTCAAGAT
CTGGATCCTCTATGCGGATGCAATAGGTGATTTTGATAAGGCATATAAGCAGTTGGAGGA
GAAAAGAATGTTTTTAGAGCATGCACTGCTCTATGATGCATATGCACTGTTTCTCTTCAG
TAAGGGGAAAGTGCTGGAGGCTGGTAAGGTGTATGAAGTTGGTATTTCCAGAAAAGCCGA
GCCACTTGATCATTTGAAGAAGATGCATACGATATTTTTAAAACACTTGGAGAAGATTGT
AGAAGAAGCAGATGCCGATGCCCAGCCGAAACCATCGAAAATACAAAAGAAAGAACCTAT
TTTGCTGGATCCATGGTCTGAGTCTACTATGAATAATTTATTGGAGAACATTAATGTTGA
TCTGAAGAAGTTCGCTGGCTATCATAAGAGCAATAAGGTCTATCATGGAAAGGTGCCATT
AACTTCGCCTCAGAATGTTTTAAGAAACAAAGTCATTGAATTAGGTGGTAGAAAGTACCA
GATCAAAGGTTCTCCTGGTACTGGTGCTTTTGCAAAAGTTTACAAAGCCAGTGTCGATGG
TAATACAGAAGACCTGGTTGCTTTAAAGATTCAGAAACCACCATTTCCTTGGGAATTTTA
CATGTATCGCCAGCTTGATACGCGCGTATCTGATATTGAGAGACCAAGCTTTGGCTACAC
TCATGAAGTGCATGTATACGCTGATGTCAGTGTGCTTGTTTGTGATTACCTGCCATACGG
AACTCTTCTGGATGTTATAAATTCTCATCTAGTACTTGAACGCCATATGGATGAAGTTCT
ATGCATATATTACACTATAGAGATGCTGCGCATGTTGGAAACACTGCACAGCGTTGGCAT
AATTCATGGTGATTTCAAGCCTGACAATATGCTTGTTTGCTACCCAAGTGGAGAAATCAC
AGACGAAACCTTCAAAGGCGAGACAAGATCCGAGCGGAATCAGGGGCTCTGCCTTGTTGA
CTGGGGCCGTGGCATCGACCTGAACCTCTTCCCATCCGGTGCGGAGTTCTACGGCGACTG
CCGAACCTCCGGGTTCAGCTGCGTCGAGATGCAGGAACAGAGAGCCTGGACGTTTCAGGC
TGACACTTACGGCCTCTGCGTCATCGCGCACATGATGCTACATGGGACGCAGATGAGCAT
CCAGAAGACGCCCAGGCCCGATGGAAGCTACATGTACCAGCCCACATCGCCGTTCAAAAG
GTACTGGAACGTGGAGCTGTGGAAAAACCTCTTCTCCACGCTGCTCAACGCGACCTCCAA
CGGCAGCGACGCGGCCGTGCTCCGGAGCCTCCGGATGTCCTTCCAGGAGTACCTGTGCAG
CAACCGGCAGCTCGTCGGCAAGCTGAACCAGCAACTGGCCAAGCAGAAGACCTCCCTGTG
CCTATCCTGACCGAGACATATACGCATCTCGCGTTTCATCCTCATCATTTTTCCCGATTC
CCTCGTGTTGCCTGTGTGTAAAGTGGTGGAGTATAAGATACCTTCCGTAACTTCGTAGCA
CTTCCTCTGTGCGTGCGTGTGCAGCAGTAATTAACGTGCCACATCTCCACTTTGAAAGCT
GAAACATCTACTATTGGGCCAGATGG

CDS

1683 bp

>Os07t0508500-01 Ser/Thr kinase, Generation of proper tension between homologous kinetochores
ATGGTTCTGCTCGAACGCACGCCGTTGGTGGTGCCCGAGGCAGCAGCAGCAGCCGCCGCC
GCCTCCAGCCCGCTCCGGAGGCCGTCGCCTAGGGTTCTGAGGGAGGTGCCCCCGCCCCCC
CTCGATCCCATCCTCCCCTACCTCAGGTCTATCAACAAGGCTATGGATGAGCTCAGGACA
GGCCCAAAATTTGAAGCAGCAGCGCTTGATCGGCTCAAGATTTGTGTAATGGAATGCATT
GATAAGTATGGTGACGATTACCAGTACTCCACAGACCCCCGACTCCTCAAGATCTGGATC
CTCTATGCGGATGCAATAGGTGATTTTGATAAGGCATATAAGCAGTTGGAGGAGAAAAGA
ATGTTTTTAGAGCATGCACTGCTCTATGATGCATATGCACTGTTTCTCTTCAGTAAGGGG
AAAGTGCTGGAGGCTGGTAAGGTGTATGAAGTTGGTATTTCCAGAAAAGCCGAGCCACTT
GATCATTTGAAGAAGATGCATACGATATTTTTAAAACACTTGGAGAAGATTGTAGAAGAA
GCAGATGCCGATGCCCAGCCGAAACCATCGAAAATACAAAAGAAAGAACCTATTTTGCTG
GATCCATGGTCTGAGTCTACTATGAATAATTTATTGGAGAACATTAATGTTGATCTGAAG
AAGTTCGCTGGCTATCATAAGAGCAATAAGGTCTATCATGGAAAGGTGCCATTAACTTCG
CCTCAGAATGTTTTAAGAAACAAAGTCATTGAATTAGGTGGTAGAAAGTACCAGATCAAA
GGTTCTCCTGGTACTGGTGCTTTTGCAAAAGTTTACAAAGCCAGTGTCGATGGTAATACA
GAAGACCTGGTTGCTTTAAAGATTCAGAAACCACCATTTCCTTGGGAATTTTACATGTAT
CGCCAGCTTGATACGCGCGTATCTGATATTGAGAGACCAAGCTTTGGCTACACTCATGAA
GTGCATGTATACGCTGATGTCAGTGTGCTTGTTTGTGATTACCTGCCATACGGAACTCTT
CTGGATGTTATAAATTCTCATCTAGTACTTGAACGCCATATGGATGAAGTTCTATGCATA
TATTACACTATAGAGATGCTGCGCATGTTGGAAACACTGCACAGCGTTGGCATAATTCAT
GGTGATTTCAAGCCTGACAATATGCTTGTTTGCTACCCAAGTGGAGAAATCACAGACGAA
ACCTTCAAAGGCGAGACAAGATCCGAGCGGAATCAGGGGCTCTGCCTTGTTGACTGGGGC
CGTGGCATCGACCTGAACCTCTTCCCATCCGGTGCGGAGTTCTACGGCGACTGCCGAACC
TCCGGGTTCAGCTGCGTCGAGATGCAGGAACAGAGAGCCTGGACGTTTCAGGCTGACACT
TACGGCCTCTGCGTCATCGCGCACATGATGCTACATGGGACGCAGATGAGCATCCAGAAG
ACGCCCAGGCCCGATGGAAGCTACATGTACCAGCCCACATCGCCGTTCAAAAGGTACTGG
AACGTGGAGCTGTGGAAAAACCTCTTCTCCACGCTGCTCAACGCGACCTCCAACGGCAGC
GACGCGGCCGTGCTCCGGAGCCTCCGGATGTCCTTCCAGGAGTACCTGTGCAGCAACCGG
CAGCTCGTCGGCAAGCTGAACCAGCAACTGGCCAAGCAGAAGACCTCCCTGTGCCTATCC
TGA

Protein

561 aa

>Os07t0508500-01 Ser/Thr kinase, Generation of proper tension between homologous kinetochores
MVLLERTPLVVPEAAAAAAAASSPLRRPSPRVLREVPPPPLDPILPYLRSINKAMDELRT
GPKFEAAALDRLKICVMECIDKYGDDYQYSTDPRLLKIWILYADAIGDFDKAYKQLEEKR
MFLEHALLYDAYALFLFSKGKVLEAGKVYEVGISRKAEPLDHLKKMHTIFLKHLEKIVEE
ADADAQPKPSKIQKKEPILLDPWSESTMNNLLENINVDLKKFAGYHKSNKVYHGKVPLTS
PQNVLRNKVIELGGRKYQIKGSPGTGAFAKVYKASVDGNTEDLVALKIQKPPFPWEFYMY
RQLDTRVSDIERPSFGYTHEVHVYADVSVLVCDYLPYGTLLDVINSHLVLERHMDEVLCI
YYTIEMLRMLETLHSVGIIHGDFKPDNMLVCYPSGEITDETFKGETRSERNQGLCLVDWG
RGIDLNLFPSGAEFYGDCRTSGFSCVEMQEQRAWTFQADTYGLCVIAHMMLHGTQMSIQK
TPRPDGSYMYQPTSPFKRYWNVELWKNLFSTLLNATSNGSDAAVLRSLRMSFQEYLCSNR
QLVGKLNQQLAKQKTSLCLS*

5'UTR

chr07:19325781..19325967 (+ strand) : 187 bp

CDS

chr07:19325968..19326113 (+ strand) : 146 bp

chr07:19326916..19327075 (+ strand) : 160 bp

chr07:19327163..19327320 (+ strand) : 158 bp

chr07:19327431..19327524 (+ strand) : 94 bp

chr07:19328698..19328808 (+ strand) : 111 bp

chr07:19328888..19328975 (+ strand) : 88 bp

chr07:19329194..19329297 (+ strand) : 104 bp

chr07:19329375..19329446 (+ strand) : 72 bp

chr07:19329529..19329618 (+ strand) : 90 bp

chr07:19329730..19329887 (+ strand) : 158 bp

chr07:19330719..19330773 (+ strand) : 55 bp

chr07:19330866..19331000 (+ strand) : 135 bp

chr07:19331122..19331243 (+ strand) : 122 bp

chr07:19331495..19331684 (+ strand) : 190 bp

3'UTR

chr07:19331685..19331880 (+ strand) : 196 bp

FASTA

>Os07t0508500-01 class=Sequence position=chr07:19325781..19331880 (+ strand)
CCCAAGCGAT CCGCATCCCA AACCATTCGA AATTCAAATT ATTCCCCTCT TCCGCTCCAT CTCCTTCCCG TCTTTCTCTC
TCCACACAGA CAGCGCACGC ATCCACCACC CCCCAACACG GGAGCGGAGA GCTCGCCGCC GGCGATCGCC GCAGGATTCT
GAGGGCTTCT TCCGGCGGCC ACGGGAGATG GTTCTGCTCG AACGCACGCC GTTGGTGGTG CCCGAGGCAG CAGCAGCAGC
CGCCGCCGCC TCCAGCCCGC TCCGGAGGCC GTCGCCTAGG GTTCTGAGGG AGGTGCCCCC GCCCCCCCTC GATCCCATCC
TCCCCTACCT CAGGTAATGG CTAGATCAGT ATCCATATCA GCACCTGTTC CCTTCGATTT AGGTCCTATT TGGGGGCGTG
GGATTCCGCC GTAGCGCTGC GTGGAATAAT GCTTGGTTTC GCCTCAAGTT GTGTGGCGTA CGCATCGTAC TGGGATTCTG
TCCCTTCCTC TGAGTTATGT AGTTAATTGG GCGTGTGATT TAGATTTTGA CACTTCGCCT CTGCGATTCC TGTTCAATTG
CTCAGTGGCA GTGTGCAGTT GAACTTGGAC GAACGGAAAT GTGAGAAATG GGGGCGTGTG TGTTCCGAAA AAAAAAAAAG
AAAAGCAAAG GGTATGACCA CCACTGTTTG AGTGTCTGGC AACGACAGAA GTGCATTTTG CCGAGACATT GTGACTGGTC
ACTCGTAATG TCCAGTGTTG GGACTTGGGA AGGATTTAGT TTTGGAGCTG ATTTGTTTTG TGCAGCTAGG TTGATTTTTC
TTGTGAAGGA TTAGCTTGTT CATGTGGAGA CGGTTCTCTT ATTCCTTTAT CAGTTCTTGA ACTGTCAAGT AATGTAATGT
GCCCACTTTC TGTGCTCCTT CTGTACTAAT GTGCTGCTTT CTGATAGGTC CTTTTGGTAA AAACTTTGCA TATATAACTT
ATTTTTATGT TCCTGGTACT ATTATATCTA TTTTATAAGG TAAATCTAAT CTTTCATGCA CATGCTGGTA TTCATGCATA
ATTTATCTAT GTATCACTGC GGTTTGTTTG TCCTGGTCAG GGCCCCAGTC CTGGTGTATG CATTCGTTTA TGTTAGTTTC
TGACTTGGTA TTCAGGTCTA TCAACAAGGC TATGGATGAG CTCAGGACAG GCCCAAAATT TGAAGCAGCA GCGCTTGATC
GGCTCAAGAT TTGTGTAATG GAATGCATTG ATAAGTATGG TGACGATTAC CAGTACTCCA CAGACCCCCG ACTCCTCAAG
ATCTGGATCC TCTATGTAAT TGTTTGGCTT TGAAGTTTCA ATTCTTACCT TATCCATTTT CTATCCTTTT GCTCATTTCC
CCCCCACTTT GTTCTATGTT AGGCGGATGC AATAGGTGAT TTTGATAAGG CATATAAGCA GTTGGAGGAG AAAAGAATGT
TTTTAGAGCA TGCACTGCTC TATGATGCAT ATGCACTGTT TCTCTTCAGT AAGGGGAAAG TGCTGGAGGC TGGTAAGGTG
TATGAAGTTG GTATTTCCAG GTTAGTATGA CACTGAATTA TGTTTTTGTT GAAGTGAACT TTTTGGGCAG CAACAATCTG
ATGTCAAATT TGTCATGTTG ATGTGATCGC AAATCATTTC CGTGGACCAG AAAAGCCGAG CCACTTGATC ATTTGAAGAA
GATGCATACG ATATTTTTAA AACACTTGGA GAAGATTGTA GAAGAAGCAG ATGCCGATGC CCAGGTATGA TAACTGTGTG
GTGGAATGGA CATTAGTTGA GTCCTTGAAT ATTTGTCAAA TGATTCACAT ATTTCATATT CAATTGCATT TTTAGTAATC
AGGACATTGT GGCTGTGTTG TAGATTTGTT AGTATTTTAG CTATGGTCAG TTGGTCACAA GGCTGACAAA CTTGCAGCAG
TAAGAACTAA GAACTGCTTT GATATTGTTT CTTACATGAT ATTTCTCTGT GGTGGAACAT TTGTTTTTCC AAAAAAGGTT
GGCAAGCAAT AGGATAATTG TCTTCACATT TCTGTGCATG TGAACTGTGA TACATTCTAC ATAATTTATT CATTTATTTG
CATGTTTGCA TGTTGTGAAC TTAATATTTA TTTGGGGCTA ATCACAATGA TATCTACTTT GTACTTGCCG ATCTTTACTA
GCTCGAACAT CTATAACATC TATTTCAACT AAATACATGA CGGTTTATTT TACATTTTCA TGGAAAGAGT TTCTGTTCTG
TCATTCCTGC AACTCTATTT ATACAAAAAT AGCATGATTC TAGTTATTTA GAGTGGCTTT TTTTATTATA TGTTTAGGGA
TATATTTTAT TTAGTTTAAT CATAGTTGGG AATGAATTTC AGGTTGTACT TTCCACTGAT TCTTGTGGTG TATGTGTTCT
ATTATGAGTT TGTCTCGGAA ATATATTATT TATGCTATGT GGTACATTGA TAGAATCGGG AGTGCATTTG CACAGCTTTA
CCATAGTGAA GTCAGAACAT AAATATAGGG CACTATCAGC ATAACAGTGC CATACCAAAC AATCTTCTTA TACGGTTCAA
TTCATAAATA AATAGAGAAA ATCGAGCAAA TTGCAAAAGC AAAGAATAAA ATGAAATATC GGGCTGAAGC CACATGATGT
GCCATTGAAA GCTACATCCC TGCCCCTGCT TGAGTGGACT AATCATTACT AGATAAAGAA ACATGAGACA TGCAATTTCT
ATATGTTTTC GAAGAACAAT ATCTATATAA CCCTGTTAAG CTTGTGAAGT AACTTATGCA AAAACCTTTT TTTGTTTCTT
TTACTTGTCA TTACTGGCCA TTATTGTAGC CAGCATATAT TATAGTCGCC TAATGCTATT CTTCTTTGTG GATGATTCAC
CATACTAACT CCATTTTTTT TTGTTACTGT CTGCTAGCCG AAACCATCGA AAATACAAAA GAAAGAACCT ATTTTGCTGG
ATCCATGGTC TGAGTCTACT ATGAATAATT TATTGGAGAA CATTAATGTT GATCTGAAGA AGTTCGCTGT AAGTTGCATT
TACTCTATAT GATTCGCTAG TGTTTATCTT AGCTCTCATC TTGGACGGTT GCCCGAATCC TTGACAGGGC TATCATAAGA
GCAATAAGGT CTATCATGGA AAGGTGCCAT TAACTTCGCC TCAGAATGTT TTAAGAAACA AAGTCATTGA ATTAGGTATA
AACTATAATT TCTTGCTTGT CAGTCTTTTA CCAAAACTAT AATCATTTTT GTAGTTTGGC TCCTTTATGA TCCATGCTCT
GTAAGTCACA ATGAATACAT AATAATGCTC CTTGAAAAAA AGGAAGAAAT ATACCCTTTT TTATTTAGAA AAAGGCCATT
TATATTGATG ACATAACAAA AGTTTAGTTA CAAATCCCTT TTGTTGCACC AAGGTGGTAG AAAGTACCAG ATCAAAGGTT
CTCCTGGTAC TGGTGCTTTT GCAAAAGTTT ACAAAGCCAG TGTCGATGGT AATACAGAAG ACCTGGTTGC TTTAAAGGTG
AGTCATACTT CCATTTGTCT TACTGAAGCC TGCTTTTTTC ATCAGATTCC TCTACTGAAC TTGCCCGTTT GCAGATTCAG
AAACCACCAT TTCCTTGGGA ATTTTACATG TATCGCCAGC TTGATACGCG CGTATCTGAT ATTGAGGTAC AGAAATTATC
TTTAAGAAGA CCATAACATT TGTAATTGTA AAATTATGAT TCACACTGCA AAATAATTTT ACTTCCAGAG ACCAAGCTTT
GGCTACACTC ATGAAGTGCA TGTATACGCT GATGTCAGTG TGCTTGTTTG TGATTACCTG CCATACGGAA CTCTTCTGGT
AAAATACTTT ATGTATTAAT TTTTTTTTTT GAGATCATGA TCATGCAAAA CTAGCATTTT GTGCCCGGAT TAGTGAATCT
GTGTTTGATA AGATGCAAAT CTTTTGCAGG ATGTTATAAA TTCTCATCTA GTACTTGAAC GCCATATGGA TGAAGTTCTA
TGCATATATT ACACTATAGA GATGCTGCGC ATGTTGGAAA CACTGCACAG CGTTGGCATA ATTCATGGTG ATTTCAAGCC
TGACAATATG CTTGTTTGCT ACCCAAGGTA AGTAGAGGTA ACCAGCTTAG CTTTCAAGTT AGAACACTTG ATGGAGCTTC
CTCCCTCTTC CTCTTGTGAT CTCTAACTGA AATATGGGCA AAACACACAC ACACACACAC ACACACACTC TCTCTCTCTC
TCTCACACAG ACACACACAA AACTATCCAG TGACCATTGA CATCTTACTT TTCATAAAAT CGACAGATTT ATTCTAGTTG
CAATATTTGT GTGCCGTCCA TTTGCCCAGT GCCCATATTC TCTTGCTATT TGTTTTGGAC AGATCTTGTT ACCATGTTTG
TGGGTGATGA TGTCTGTGCT GTAAATATTT TACTCCAAGC TTCACAACCA TCTACAACTT TTATAAACTA GATGTTATAT
TTAAACTGAT CTAATAACAT AGTTTTCAAT GAAAATATTT GACATGGATG GTCATAACAA CAAGCATGTT GGTAAGTGGT
CAATTTGTTG GCCCCAGATG TTGGGTTTGG TGGGGGCAAA GATCCTTGCT GATTTACTAC TGTTTCAATT ACTTTATATG
AGCGGTTACT GGAATCTTGC TTGATGGCTC CATCCTCCAT GTTTCCGCTG AGATGACGAT TTTTTTTGTC ATTTTTGTTG
GCCATTTGCT GCTATTGGCT TGTTTCGGCC AAAACTCAAT TATAACCCAT CTAGTACATG TTACGCCTGA AAAAAAAAGA
AAGAGTAAAC CTAATGCTAG TGTCTGTTCC TTTTTGTTCT CGCTATCCAA GTCTTCACCT CTTCAATCTT TAGCCCTTGT
CTCGACATGT AATTTTCGTT CACCCGCATC TTTGTTTTGC GTGTGGTGGT CTGTGCAGTG GAGAAATCAC AGACGAAACC
TTCAAAGGCG AGACAAGATC CGAGCGGAAT CAGGTCAGCT TCTCAATCCC AAGTTCCCAA CACGCCGAGA AACTTGGTTA
AGATGTTCTG GATATCTCCT GATGCTTATA GGATTCCCAT TCCAGGGGCT CTGCCTTGTT GACTGGGGCC GTGGCATCGA
CCTGAACCTC TTCCCATCCG GTGCGGAGTT CTACGGCGAC TGCCGAACCT CCGGGTTCAG CTGCGTCGAG ATGCAGGAAC
AGAGAGCCTG GACGTTTCAG GTATCTGTAC CCTCCCAAGC TACTTACTCA AAACCTCCTC TCACCTAGAC ATCTCTGAAA
GCAACCCCTG CCTGACGCTG CCAGTTTGTT TGTTGGTTGG TTGATTGGTT TCTTCCTGCA GGCTGACACT TACGGCCTCT
GCGTCATCGC GCACATGATG CTACATGGGA CGCAGATGAG CATCCAGAAG ACGCCCAGGC CCGATGGAAG CTACATGTAC
CAGCCCACAT CGCCGTTCAA AAGGTGCTTT GATGCCATTG CCTATACACC TCTTTGATAA TTTCCTCTAT CCCAAAATAT
AGCTACTATG AGATATTTTT CAGTACTATG AATCTGAACA GGTTTAGAAA ATATCTCATC CTATGCTAGT TAGTTATATT
TTAAGATAAA GGTAGTAGTA ATTACCATGA TTCGCAGTAG CGTAAATAAA TCAGAGATTA GATTAGATGG CATATGTAAC
AGGAGCTGTT TGCTGCCATT TTGCCCCTTG ACAGGTACTG GAACGTGGAG CTGTGGAAAA ACCTCTTCTC CACGCTGCTC
AACGCGACCT CCAACGGCAG CGACGCGGCC GTGCTCCGGA GCCTCCGGAT GTCCTTCCAG GAGTACCTGT GCAGCAACCG
GCAGCTCGTC GGCAAGCTGA ACCAGCAACT GGCCAAGCAG AAGACCTCCC TGTGCCTATC CTGACCGAGA CATATACGCA
TCTCGCGTTT CATCCTCATC ATTTTTCCCG ATTCCCTCGT GTTGCCTGTG TGTAAAGTGG TGGAGTATAA GATACCTTCC
GTAACTTCGT AGCACTTCCT CTGTGCGTGC GTGTGCAGCA GTAATTAACG TGCCACATCT CCACTTTGAA AGCTGAAACA
TCTACTATTG GGCCAGATGG 

Locus: Os07g0508500

Loading...

Locus: Os07g0508500

Loading...