Os07t0522500-01

Locus

Os07g0522500

Description

ATP binding cassette (ABC)-type transporter, Cadmium tolerance

RAP-DB Gene Symbol Synonym(s)

OsABCG43, PDR5, OsABCG43/PDR5

RAP-DB Gene Name Synonym(s)

ABC transporter G43, pleiotropic drug resistance 5

CGSNL Gene Symbol

PDR5

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 5

Oryzabase Gene Symbol Synonym(s)

ABCG43, OsABCG43, ABCG43/PDR5, OsPDR5

Oryzabase Gene Name Synonym(s)

ABC transporter G43, pleiotropic drug resistance 5, ABC transporter superfamily ABCG subgroup member 43

Transcript Evidence

AK105311 (truncated)

XM_015791089

Protein Evidence

Q8GU86

Literature

PMID: 21670506

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

June 22, 2021

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

ABC-transporter N-terminal domain (IPR029481)

ABC transporter-like (IPR003439)

ATP-binding cassette transporter, PDR-like subfamily G, domain 1 (IPR034001)

AAA+ ATPase domain (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

ATP-binding cassette transporter, PDR-like subfamily G, domain 2 (IPR034003)

Full-length cDNA

001-117-C08(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os07t0522500-01)

RiceXPro (AK105311)

Others

Oryzabase (9426)

KEGG (Os07t0522500-01)

Transcript

4697 bp

>Os07t0522500-01 ATP binding cassette (ABC)-type transporter, Cadmium tolerance
AGCCTAGCAACCACACGGCGACGGTCAGAACGAACGCCTCGCCGCCGTCGATCGCCGGCG
GCCGGAACTATCTCGCAAAGTAATCGATCGAAGGTATCAAAAGCATCATCTGAGCTGAGc
tgagcggcggcgcgatggcgggggagataaccccgtcggggagccggcggagctggctgt
cgtcgggggcggcgtcgctggcgcggtcgctgcgcgacggggacgacccgttccggcggt
cggcggcggcgagccggcgcgacgccggggacgacgaggagaacctgcggtgggcggcgc
tggagaagctgccgacgtacgaccgcatgcgccgcggcatcctccgcaaggcggtggacg
gcggcggcgacggcgagggGGCCGGGTCGCTGTTCAAGGCCGACGAGGTGGACATCGCCA
ACCTCGACCCGCGCGAGGGCCGCGAGCTCATGGAGCGCGTCTTCAAGGCCGTCGAGGACG
ACAACGAGCGCTTCCTCCGCCGCTTCCGCGACCGCCTCGACCAGGTTGGGATTGAGCTGC
CGAAGATCGAGGTGAGGTACCAGCATCTGGACATCGAGGCGGACGTGCACGTCGGCAAGC
GCGCGCTGCCCACGCTGCTCAACGCCACCATCAACACGCTAGAGGGTCTCGTTAGCCTAT
TTATCTCGTCGAACAAGAGGAAGCTTAAGATACTCAACGATGTTAATGGCATTATCAAGC
CATCAAGGATGACTCTTCTTCTCGGGCCTCCATCGTCTGGAAAAAGCACACTTATGCGAG
CACTAACCGGCAAGCCTGATAAAAATCTCAAGGTGTCTGGCGAGATCACATACTGTGGTC
ATACGTTTAAAGAGTTCTATCCTGAGAGGACTAGTGCTTACGTCAGTCAGCATGATCTGC
ACAATCCTGAGATGACAGTAAGAGAGACACTGGATTTCTCGAGACGATGCCTTGGAAGTG
GTGCCAGATATGATATGCTGTCAGAATTAACAAGACGGGAACGTAATGCAGGCATTAAAC
CTGACCCTGAGATTGATGCTTTGATGAAGGCAACTGTAGTAGAAGGAAAACAGAACAATA
TTGTCACAGATCTTGTTCTGAAGGCGCTTGGACTGGACATTTGTGCCGATACTATTGTTG
GTGGTGCTATGATAAGAGGCATTTCTGGTGGTCAAAAGAAACGTGTGACTACTGGGGAGA
TGCTCACTGGACCAGCAACAGCTTTGTTCATGGATGAAATATCTACTGGGCTTGATAGTT
CTAGCACATTTCAGATTGTCAAATACATCAGACAGGTGACCCATGTGATGAATGCTACAG
TGATGATGTCTCTCCTACAGCCTCCACCTGAGACCTATGCTTTATTCGATGACATCGTTC
TTATAGCAGAAGGTTACATAGTCTACCATGGACCACGGGAGAACATACTTGAATTCTTTG
AGAGTGCTGGTTTTCGGTGTCCTGAACGGAAAGGAGTGGCCGACTTTCTTCAAGAGGTGA
CTTCTAGGAAAGATCAACAGCAATACTGGTTCCTTGAGCAGGATCATTATCGTTATGTGT
CAGTCGAAGAGTTTGCTCAGAATTTCAAGAAATTTCATGTTGGGCAAAAGCTGCAGAAAG
AGCTTCAAGTTCCCTATGACAAATCTAAGACACATCCTGCTGCATTGACTACCAAGAAGT
ATGGGTTATCTAGTCTAGAGTCCCTTAAGGCAGTGATGTCAAGAGAGTGGTTGCTAATGA
AGCGGAATTCATTCCTCTTCATATTCAAGGCCTTTCAACTGTTTGTCCTTGGATTTATAA
CCATGACTCTGTTTTTGAGAACAAAGATGCCCCACGAGAAATTTTCTGATACCTCTAAAT
ATGTTGGTGCTTTAACTGCTTCTTTGATTACAATCATGTTCAATGGTTTTGGTGAACTTC
AATTGACTATAGATAAACTCCCGATATTCTACAAACAAAGAGACTTCCTGTTCTTTCCAG
CATGGACCTATGGACTTGCAAACATCATTCTGAAGGTGCCTTTATCCCTTATGGAATCAT
CTCTTTGGATAGTTTTGACATATTATGTTGTGGGTTTTGCACCTGCTGCAGGAAGGTTCT
TCAAGCAGTTTCTTGCATACTTTTGGACACACCAGATGGCCTTGGCCTTGTTCCGGTTGC
TAGGTGCAATTTTAAGATCAATGGTGGTAGCTAATACATTTGGCATGTTTGTGCTGCTAC
TTATTTTCCTCTTTGGAGGATTTCTCGTTTCCAGAAAGGACATTAAACCGTGGTGGATAT
GGGGCTACTGGACATCTCCCATGATGTATAGCAATAATGCCTTATCAGTTAATGAATTCC
TTGCCAGTAGGTGGGCCATTCCAAACAATGACTCAAGTATCAGTGCACCAACAATAGGGA
AGGCTTTTCTTCAATCCAAAGGCTACTTCACAGGAGAATGGGGGTATTGGCTTTCCATTG
GAGCCATGATAGGATTTATGATTGTTTTTAACATTCTCTACCTTTGTGCTCTTACATTCC
TAAGACCTATTGGCAGTGCAAGCACTGTTGTTTCTGATGATGACACCAAAAGTGAGCTCG
AAGCAGAATCTAATCAGGAACAAATGTCAGAGGTTATTAATGGTACGAATGGAACAGAAA
ACAGAAGAAGCCAGAGAGGAATGGTCTTGCCATTCCAGCCTCTTTCCCTTTCTTTCAACC
ATATGAACTACTACGTTGACATGCCTGCTGAAATGAAAGCACAAGGATTCACAGAAAGCC
GCCTCCAACTACTATCTGATATTAGTGGTGCATTCCGACCAGGTGTTCTAACAGCACTAG
TTGGTGTCAGTGGAGCTGGAAAAACCACTCTAATGGATGTACTGGCAGGAAGAAAGACTA
GTGGAACGATTGAGGGAGATATCAAGCTTTCTGGTTACCCTAAAAAACAAGAAACCTTTG
CTCGCATCAGTGGCTATTGTGAACAAACTGATATACATTCACCAAATCTTACTGTATATG
AATCCATTGTTTATTCTGCTTGGCTGCGCCTTTCCTCAGAAGTTGATAAGAACACCAGGA
AGGTGTTTGTGGAGGAAGTGATGTCACTAGTTGAGCTTGATGTATTGCGTGATGCTCTGG
TTGGTCTCCCTGGTGTTAGTGGGTTGTCAACTGAACAAAGGAAGAGGCTGACAATCGCAG
TAGAACTAGTGGCAAATCCTTCAATTATCTTCATGGATGAACCAACTTCAGGTCTTGATG
CTAGAGCTGCAGCAATTGTTATGCGTACTGTGAGAAATACAGTTAACACAGGACGAACTG
TGGTTTGCACAATCCATCAACCTAGCATTGATATCTTTGAGTCTTTTGATGAGCTTCTGT
TGCTAAAGAGGGGAGGACGGGTTATATATGCTGGCCAGCTTGGTCTCCATTCACAAATAC
TAGTCGAATATTTCGAGGCAATTCCAGGGGTCCCAAAAATCACAGAAGGATATAACCCAG
CAACATGGATGCTTGAAGTTAGCTCTTCTCTAGCTGAGGCTCGTCTGGACATAGACTTTG
CTGAAGTTTATGCCAATTCTGCACTTTACCGGAGCAATCAAGAACTTATTAAGCAGCTGA
GTGTTCCACCTCCAGGCTTCCAGGATCTCTCATTTCCTACCAAATATTCCCAGAATTTCC
TAAATCAGTGTGTGGCAAATACATGGAAGCAATTTCAATCTTATTGGAAGGATCCACCCT
ACAATGCTATGCGTTATGTTATGACGCTTCTCTATGGTCTTGTGTTTGGTACTGTCTTTT
GGCGGAGGGGAAAGAATATAGAGTCCGTGAATGATCTGAACAATCTACTTGGAGCCACCT
ATGCTGCTGTTTTCTTCCTTGGAGCAGCAAATTTGCTCACACTTTTGCCTGTGGTGTCAG
TTGAGAGGACAGTCTTTTACCGTGAAAAGGCAGCAGGGATGTACTCTCCACTGTCTTATG
CGTTTGCACAAGGATTTGTCGAGTTCTGCTACAGTGCAGTTCAAGGTGTTCTTTACACTA
TCCTCATCTATTCCATGATTGGCTATGAGTGGAAGGCGGACAAGTTCTTCTACTTCCTGT
TCTTTATGATTGCGGCCTTCGCCTACTTCACATTGTTTAGCATGATGCTGGTTGCGTGCA
CTGCTTCGGAAATGCTTGCGGCCGTTCTTGTTTCATTTGTGCTCTCCTCGTGGAACAATT
TTGCCGGATTCATTATACCCCGTCCACTGATTCCTGTTTGGTGGAGATGGTTCTATTGGG
CCAACCCGGTCTCCTGGACCATCTATGGAGTGATTGCGTCGCAGTTTGCGGACAGCGACC
GTGTTGTCACCGTTCCTGGCCAATCTACCACCATGGTGGTGAAGGATTTCTTGGAGAAGA
ACATGGGCTTTAAGCACGACTTCCTCGGCTACGTTGTGCTGGCTCATTTCGGCTACGTCA
TCATCTTCTTCTTCCTCTTTGGATACGGCATCAAGTGCTTGAACTTCCAGAAACGGTAGG
AGGCCGGTGTCCAGCAGGATGTCAATCCGAGGTCACGTTTTTGGAGTGTAAAGCAAATGT
AGCAACTTAATACCGATGCTTTTTTTGTGTAGATATATAGTCTGTTCGATATCTGCTAGC
TTGTATTGACACTTAATGTACAACATTATTTACTCAAATGTTCTGAGTTTATGGTATATT
ATTCTTTTTCTATGTTA

CDS

4365 bp

>Os07t0522500-01 ATP binding cassette (ABC)-type transporter, Cadmium tolerance
atggcgggggagataaccccgtcggggagccggcggagctggctgtcgtcgggggcggcg
tcgctggcgcggtcgctgcgcgacggggacgacccgttccggcggtcggcggcggcgagc
cggcgcgacgccggggacgacgaggagaacctgcggtgggcggcgctggagaagctgccg
acgtacgaccgcatgcgccgcggcatcctccgcaaggcggtggacggcggcggcgacggc
gagggGGCCGGGTCGCTGTTCAAGGCCGACGAGGTGGACATCGCCAACCTCGACCCGCGC
GAGGGCCGCGAGCTCATGGAGCGCGTCTTCAAGGCCGTCGAGGACGACAACGAGCGCTTC
CTCCGCCGCTTCCGCGACCGCCTCGACCAGGTTGGGATTGAGCTGCCGAAGATCGAGGTG
AGGTACCAGCATCTGGACATCGAGGCGGACGTGCACGTCGGCAAGCGCGCGCTGCCCACG
CTGCTCAACGCCACCATCAACACGCTAGAGGGTCTCGTTAGCCTATTTATCTCGTCGAAC
AAGAGGAAGCTTAAGATACTCAACGATGTTAATGGCATTATCAAGCCATCAAGGATGACT
CTTCTTCTCGGGCCTCCATCGTCTGGAAAAAGCACACTTATGCGAGCACTAACCGGCAAG
CCTGATAAAAATCTCAAGGTGTCTGGCGAGATCACATACTGTGGTCATACGTTTAAAGAG
TTCTATCCTGAGAGGACTAGTGCTTACGTCAGTCAGCATGATCTGCACAATCCTGAGATG
ACAGTAAGAGAGACACTGGATTTCTCGAGACGATGCCTTGGAAGTGGTGCCAGATATGAT
ATGCTGTCAGAATTAACAAGACGGGAACGTAATGCAGGCATTAAACCTGACCCTGAGATT
GATGCTTTGATGAAGGCAACTGTAGTAGAAGGAAAACAGAACAATATTGTCACAGATCTT
GTTCTGAAGGCGCTTGGACTGGACATTTGTGCCGATACTATTGTTGGTGGTGCTATGATA
AGAGGCATTTCTGGTGGTCAAAAGAAACGTGTGACTACTGGGGAGATGCTCACTGGACCA
GCAACAGCTTTGTTCATGGATGAAATATCTACTGGGCTTGATAGTTCTAGCACATTTCAG
ATTGTCAAATACATCAGACAGGTGACCCATGTGATGAATGCTACAGTGATGATGTCTCTC
CTACAGCCTCCACCTGAGACCTATGCTTTATTCGATGACATCGTTCTTATAGCAGAAGGT
TACATAGTCTACCATGGACCACGGGAGAACATACTTGAATTCTTTGAGAGTGCTGGTTTT
CGGTGTCCTGAACGGAAAGGAGTGGCCGACTTTCTTCAAGAGGTGACTTCTAGGAAAGAT
CAACAGCAATACTGGTTCCTTGAGCAGGATCATTATCGTTATGTGTCAGTCGAAGAGTTT
GCTCAGAATTTCAAGAAATTTCATGTTGGGCAAAAGCTGCAGAAAGAGCTTCAAGTTCCC
TATGACAAATCTAAGACACATCCTGCTGCATTGACTACCAAGAAGTATGGGTTATCTAGT
CTAGAGTCCCTTAAGGCAGTGATGTCAAGAGAGTGGTTGCTAATGAAGCGGAATTCATTC
CTCTTCATATTCAAGGCCTTTCAACTGTTTGTCCTTGGATTTATAACCATGACTCTGTTT
TTGAGAACAAAGATGCCCCACGAGAAATTTTCTGATACCTCTAAATATGTTGGTGCTTTA
ACTGCTTCTTTGATTACAATCATGTTCAATGGTTTTGGTGAACTTCAATTGACTATAGAT
AAACTCCCGATATTCTACAAACAAAGAGACTTCCTGTTCTTTCCAGCATGGACCTATGGA
CTTGCAAACATCATTCTGAAGGTGCCTTTATCCCTTATGGAATCATCTCTTTGGATAGTT
TTGACATATTATGTTGTGGGTTTTGCACCTGCTGCAGGAAGGTTCTTCAAGCAGTTTCTT
GCATACTTTTGGACACACCAGATGGCCTTGGCCTTGTTCCGGTTGCTAGGTGCAATTTTA
AGATCAATGGTGGTAGCTAATACATTTGGCATGTTTGTGCTGCTACTTATTTTCCTCTTT
GGAGGATTTCTCGTTTCCAGAAAGGACATTAAACCGTGGTGGATATGGGGCTACTGGACA
TCTCCCATGATGTATAGCAATAATGCCTTATCAGTTAATGAATTCCTTGCCAGTAGGTGG
GCCATTCCAAACAATGACTCAAGTATCAGTGCACCAACAATAGGGAAGGCTTTTCTTCAA
TCCAAAGGCTACTTCACAGGAGAATGGGGGTATTGGCTTTCCATTGGAGCCATGATAGGA
TTTATGATTGTTTTTAACATTCTCTACCTTTGTGCTCTTACATTCCTAAGACCTATTGGC
AGTGCAAGCACTGTTGTTTCTGATGATGACACCAAAAGTGAGCTCGAAGCAGAATCTAAT
CAGGAACAAATGTCAGAGGTTATTAATGGTACGAATGGAACAGAAAACAGAAGAAGCCAG
AGAGGAATGGTCTTGCCATTCCAGCCTCTTTCCCTTTCTTTCAACCATATGAACTACTAC
GTTGACATGCCTGCTGAAATGAAAGCACAAGGATTCACAGAAAGCCGCCTCCAACTACTA
TCTGATATTAGTGGTGCATTCCGACCAGGTGTTCTAACAGCACTAGTTGGTGTCAGTGGA
GCTGGAAAAACCACTCTAATGGATGTACTGGCAGGAAGAAAGACTAGTGGAACGATTGAG
GGAGATATCAAGCTTTCTGGTTACCCTAAAAAACAAGAAACCTTTGCTCGCATCAGTGGC
TATTGTGAACAAACTGATATACATTCACCAAATCTTACTGTATATGAATCCATTGTTTAT
TCTGCTTGGCTGCGCCTTTCCTCAGAAGTTGATAAGAACACCAGGAAGGTGTTTGTGGAG
GAAGTGATGTCACTAGTTGAGCTTGATGTATTGCGTGATGCTCTGGTTGGTCTCCCTGGT
GTTAGTGGGTTGTCAACTGAACAAAGGAAGAGGCTGACAATCGCAGTAGAACTAGTGGCA
AATCCTTCAATTATCTTCATGGATGAACCAACTTCAGGTCTTGATGCTAGAGCTGCAGCA
ATTGTTATGCGTACTGTGAGAAATACAGTTAACACAGGACGAACTGTGGTTTGCACAATC
CATCAACCTAGCATTGATATCTTTGAGTCTTTTGATGAGCTTCTGTTGCTAAAGAGGGGA
GGACGGGTTATATATGCTGGCCAGCTTGGTCTCCATTCACAAATACTAGTCGAATATTTC
GAGGCAATTCCAGGGGTCCCAAAAATCACAGAAGGATATAACCCAGCAACATGGATGCTT
GAAGTTAGCTCTTCTCTAGCTGAGGCTCGTCTGGACATAGACTTTGCTGAAGTTTATGCC
AATTCTGCACTTTACCGGAGCAATCAAGAACTTATTAAGCAGCTGAGTGTTCCACCTCCA
GGCTTCCAGGATCTCTCATTTCCTACCAAATATTCCCAGAATTTCCTAAATCAGTGTGTG
GCAAATACATGGAAGCAATTTCAATCTTATTGGAAGGATCCACCCTACAATGCTATGCGT
TATGTTATGACGCTTCTCTATGGTCTTGTGTTTGGTACTGTCTTTTGGCGGAGGGGAAAG
AATATAGAGTCCGTGAATGATCTGAACAATCTACTTGGAGCCACCTATGCTGCTGTTTTC
TTCCTTGGAGCAGCAAATTTGCTCACACTTTTGCCTGTGGTGTCAGTTGAGAGGACAGTC
TTTTACCGTGAAAAGGCAGCAGGGATGTACTCTCCACTGTCTTATGCGTTTGCACAAGGA
TTTGTCGAGTTCTGCTACAGTGCAGTTCAAGGTGTTCTTTACACTATCCTCATCTATTCC
ATGATTGGCTATGAGTGGAAGGCGGACAAGTTCTTCTACTTCCTGTTCTTTATGATTGCG
GCCTTCGCCTACTTCACATTGTTTAGCATGATGCTGGTTGCGTGCACTGCTTCGGAAATG
CTTGCGGCCGTTCTTGTTTCATTTGTGCTCTCCTCGTGGAACAATTTTGCCGGATTCATT
ATACCCCGTCCACTGATTCCTGTTTGGTGGAGATGGTTCTATTGGGCCAACCCGGTCTCC
TGGACCATCTATGGAGTGATTGCGTCGCAGTTTGCGGACAGCGACCGTGTTGTCACCGTT
CCTGGCCAATCTACCACCATGGTGGTGAAGGATTTCTTGGAGAAGAACATGGGCTTTAAG
CACGACTTCCTCGGCTACGTTGTGCTGGCTCATTTCGGCTACGTCATCATCTTCTTCTTC
CTCTTTGGATACGGCATCAAGTGCTTGAACTTCCAGAAACGGTAG

Protein

1454 aa

>Os07t0522500-01 ATP binding cassette (ABC)-type transporter, Cadmium tolerance
MAGEITPSGSRRSWLSSGAASLARSLRDGDDPFRRSAAASRRDAGDDEENLRWAALEKLP
TYDRMRRGILRKAVDGGGDGEGAGSLFKADEVDIANLDPREGRELMERVFKAVEDDNERF
LRRFRDRLDQVGIELPKIEVRYQHLDIEADVHVGKRALPTLLNATINTLEGLVSLFISSN
KRKLKILNDVNGIIKPSRMTLLLGPPSSGKSTLMRALTGKPDKNLKVSGEITYCGHTFKE
FYPERTSAYVSQHDLHNPEMTVRETLDFSRRCLGSGARYDMLSELTRRERNAGIKPDPEI
DALMKATVVEGKQNNIVTDLVLKALGLDICADTIVGGAMIRGISGGQKKRVTTGEMLTGP
ATALFMDEISTGLDSSSTFQIVKYIRQVTHVMNATVMMSLLQPPPETYALFDDIVLIAEG
YIVYHGPRENILEFFESAGFRCPERKGVADFLQEVTSRKDQQQYWFLEQDHYRYVSVEEF
AQNFKKFHVGQKLQKELQVPYDKSKTHPAALTTKKYGLSSLESLKAVMSREWLLMKRNSF
LFIFKAFQLFVLGFITMTLFLRTKMPHEKFSDTSKYVGALTASLITIMFNGFGELQLTID
KLPIFYKQRDFLFFPAWTYGLANIILKVPLSLMESSLWIVLTYYVVGFAPAAGRFFKQFL
AYFWTHQMALALFRLLGAILRSMVVANTFGMFVLLLIFLFGGFLVSRKDIKPWWIWGYWT
SPMMYSNNALSVNEFLASRWAIPNNDSSISAPTIGKAFLQSKGYFTGEWGYWLSIGAMIG
FMIVFNILYLCALTFLRPIGSASTVVSDDDTKSELEAESNQEQMSEVINGTNGTENRRSQ
RGMVLPFQPLSLSFNHMNYYVDMPAEMKAQGFTESRLQLLSDISGAFRPGVLTALVGVSG
AGKTTLMDVLAGRKTSGTIEGDIKLSGYPKKQETFARISGYCEQTDIHSPNLTVYESIVY
SAWLRLSSEVDKNTRKVFVEEVMSLVELDVLRDALVGLPGVSGLSTEQRKRLTIAVELVA
NPSIIFMDEPTSGLDARAAAIVMRTVRNTVNTGRTVVCTIHQPSIDIFESFDELLLLKRG
GRVIYAGQLGLHSQILVEYFEAIPGVPKITEGYNPATWMLEVSSSLAEARLDIDFAEVYA
NSALYRSNQELIKQLSVPPPGFQDLSFPTKYSQNFLNQCVANTWKQFQSYWKDPPYNAMR
YVMTLLYGLVFGTVFWRRGKNIESVNDLNNLLGATYAAVFFLGAANLLTLLPVVSVERTV
FYREKAAGMYSPLSYAFAQGFVEFCYSAVQGVLYTILIYSMIGYEWKADKFFYFLFFMIA
AFAYFTLFSMMLVACTASEMLAAVLVSFVLSSWNNFAGFIIPRPLIPVWWRWFYWANPVS
WTIYGVIASQFADSDRVVTVPGQSTTMVVKDFLEKNMGFKHDFLGYVVLAHFGYVIIFFF
LFGYGIKCLNFQKR*

5'UTR

chr07:20205306..20205439 (+ strand) : 134 bp

CDS

chr07:20205440..20205828 (+ strand) : 389 bp

chr07:20206168..20206288 (+ strand) : 121 bp

chr07:20208493..20208575 (+ strand) : 83 bp

chr07:20209398..20209482 (+ strand) : 85 bp

chr07:20209566..20209856 (+ strand) : 291 bp

chr07:20210134..20210224 (+ strand) : 91 bp

chr07:20210959..20211859 (+ strand) : 901 bp

chr07:20211980..20212140 (+ strand) : 161 bp

chr07:20212338..20212441 (+ strand) : 104 bp

chr07:20212619..20212784 (+ strand) : 166 bp

chr07:20212862..20212957 (+ strand) : 96 bp

chr07:20213273..20213379 (+ strand) : 107 bp

chr07:20214022..20214354 (+ strand) : 333 bp

chr07:20214972..20215262 (+ strand) : 291 bp

chr07:20215353..20215436 (+ strand) : 84 bp

chr07:20216466..20216599 (+ strand) : 134 bp

chr07:20216745..20216972 (+ strand) : 228 bp

chr07:20217120..20217291 (+ strand) : 172 bp

chr07:20217880..20218134 (+ strand) : 255 bp

chr07:20218226..20218498 (+ strand) : 273 bp

3'UTR

chr07:20218499..20218696 (+ strand) : 198 bp

FASTA

>Os07t0522500-01 class=Sequence position=chr07:20205306..20218696 (+ strand)
AGCCTAGCAA CCACACGGCG ACGGTCAGAA CGAACGCCTC GCCGCCGTCG ATCGCCGGCG GCCGGAACTA TCTCGCAAAG
TAATCGATCG AAGGTATCAA AAGCATCATC TGAGCTGAGc tgagcggcgg cgcgatggcg ggggagataa ccccgtcggg
gagccggcgg agctggctgt cgtcgggggc ggcgtcgctg gcgcggtcgc tgcgcgacgg ggacgacccg ttccggcggt
cggcggcggc gagccggcgc gacgccgggg acgacgagga gaacctgcgg tgggcggcgc tggagaagct gccgacgtac
gaccgcatgc gccgcggcat cctccgcaag gcggtggacg gcggcggcga cggcgagggG GCCGGGTCGC TGTTCAAGGC
CGACGAGGTG GACATCGCCA ACCTCGACCC GCGCGAGGGC CGCGAGCTCA TGGAGCGCGT CTTCAAGGCC GTCGAGGACG
ACAACGAGCG CTTCCTCCGC CGCTTCCGCG ACCGCCTCGA CCAGTAAGCA TAAAAACTTT TCTTCTTCTT CTCAGAGACC
ATATTTACGT GAGGACTGTG GAGGGGATAC GAGCGGGTCA ACTCAcgaac ccgtttatag gcaaaatgag tggataaccc
gctggctggc ttgcgggtta cctactaatt tgatatataa atgggtttat agttgatcca cttgcttctc tatgacgcgg
caagctgagt catgacacga aaacccgtag attactcttt atttaacata taagtaaatt cgtgagtcgg cccgcttgca
tccctGTGAA TTTTAACTAT TTGAATCAAA ATTTATTGTG AATTTGCTTC GTTGATTTGT AGGGTTGGGA TTGAGCTGCC
GAAGATCGAG GTGAGGTACC AGCATCTGGA CATCGAGGCG GACGTGCACG TCGGCAAGCG CGCGCTGCCC ACGCTGCTCA
ACGCCACCAT CAACACGCTA GAGGTATATA CACATGTACA TCGCTCAGCT CAGCTCAGCT CTCTAGTGTG ATCACTCAAC
AAGTTGGATG TGAAGATCAG TGGCGCCTTA ATACTTAATT TGGGGCGTAC GATGGATTTT ACTGAAATTT TAAAGGGATT
AATTAAGAAA ACTGAAGGGT ATGAAAACAT TTTTGTCTCT TAAAAAAAAA GTCATTGGAT GAAGCCACTA GATAAGTACA
TCAATCGAAA CAAGTCAAGC ATGCGCAGTA CAAAAATCAA GACCATTTTA TTGTCCGACT CTGGAGAGAG AGATTAGCTT
AATTTGGAGC TAGTAGATTC TTGTACGATG TCCACTAGCT TAGCTCACGT ATGACTGTGG GGTCCACCGT AGAATCTTGA
TAAATAGTAA TGCGTAAAAC GGCCGGTCGC GGGTTCTCGC GGCCTGCAAA TTTGGAAGGA AGCTCATGTG TTCATGCTGA
TGAGTGGCGA TTAGTCGCCG GTTAGTCAAA GCACGTTTTT GGAGCTGTGT TCGGTCGGTA GTGTTTGGAA TTTAAAGCCC
TCACACatgt agaacagttc tagtgactcc ttagcttata attaattaat tattagttat ttttttaaaa aataaattaa
tatgattttt taaaaacaac tttcgtatgt aacttttttt aaaattgtat tgtttaatag tttaaaaatc gtgcgtacag
aaaaacggga gaaaAGTTTG GGTGGTTTCG ACCTTTGACC AGCTAGCTGT TAGTCTGTTA ATGCCCACGC CCTGATCACA
ATGCGTGATA GAATTTCTGA CAGACAACGA CGCCTATAGA ATACACAATG CGTGATAGAA TTTCGCGGCT AGCAGGTCGT
CGCACACCCG ACGAAAAGTC CCACAAAACT GCACACGCAT GGTACGTACG TAGAATTAGT TAGTACTAGT CAGTAAGGAT
CAGGTTTCCC AGACCGccgg cggtaagcac gattatcacg cggtaaccgt aaaaaaccgt gtaaaattta tcaaaaattc
aaattatttt tcaaatttat ttaaatttaa gggggttatc gtggtttttt attactgtac cccgcggtaa gccggtaacc
gatggtaaTG TAAACCCTGG TAAGGATAGA TCGAGTTGTA CTCGGCTCGA GATCTTCTAG AAGTTATAGT GTACTCACGA
GATCTTTCAG ATGTGGTAAG TTTCTGGTGC TGGGTTTAAG TTTTCGCGTC TACGCTTACG CAAACGACAC CACACGTACA
CACACCGGCC GGCAGAAAAG TTTATGAGAT TTCCATATAT ATATATATAC AGTACTTGCC AATCTCGGTT GGTATAGTAC
ATGTACTAAG ATCACGGAAG GAAAGGGTGT CAAAGTCAAA CACATGATGA TTTCCCCTTG AAACTTGAAA GTGCACGAGC
AAAAATTTCA AAACAAAACA AAACAAAACA AAAACGTGCA CGAACACGAA GATGTGGGCT TTTACCAAAA GCCACTGGTT
GAGGCCTTTC CACCGGCCTA TATAGCGGCC CACTTCTTCG CGAGCCCAGG CCCATCAGAA GAGAAGTCGG CCCACAAATG
GTGGACCTTG GGCCTCGCCT GCCGCTCTGG ACTCTCCCTC CTCGAGCGGG CGATGGGCGA TGGCGGCGGA AGCATCCCGC
TTCCGTCGCC GGCTCGCCGC CGCTGCGGCG GAGGAACGGC GAGGGCGGCG CTTGTCGGCC ACGCGCGGTC AGTGGTGGTG
CGGCCTCTGC AGCTCTGCTC CCCCATGCGT CGGTCCGCCT CGCCTTCGCC TCCTCCAGTA GGAGCCGTCG GTTCGTGTGT
TTCTCCCCCC ATTCCGCTCT CGATCCGTTC CCTTCTCCAT GCGGGAGGGG GGAGGGGGGG GGGCCGGTTG CTGACGCCGT
AGAGGCAGAC GGCGCCACCA AAAGGCCTAG TTAGGGTTTG GTTGATTGAT GCCATCGAAC ATTCCCACAC GATGTGGCTA
TCGGTTTGGA GAGGGCGTTT CGTTGGTACT AATACTAGTA ATCTGAACTA GCAAAGTTCA TTGGTAATTT TTTTTTAATC
TCCAGTTGTT AAGTTTTGAC GAGCAGACTC GATTTTGCTG ATTTGTGGTT GTAGTGGCAG AAGTTCGATG AGATGCTACC
TAATGCTTAG CGTCGCTTAC TTGTTACTTG CTCTGGCTCA AACGTTGTTT TTTATGCTTC ATGACAGGGT CTCGTTAGCC
TATTTATCTC GTCGAACAAG AGGAAGCTTA AGATACTCAA CGATGTTAAT GGCATTATCA AGCCATCAAG GTACTTGGAA
ATTCTTTGAT ACTCAGCTAT GGAACGTTTT AATCCAATCG TTAATCATTT CTAGTCTTAA ATGGAACTTT ATGTTTTTAA
GCTGCATTCT AATTCTAACT AGTTTGATAA ACTATCTGTA ATTTATTAAG TAATTTCTAT TCCCAAGTGA TACAGATATA
GATATGATCT CTATGATTTA TGCAGACATG GTTACTCTGC AATTTAACTT TTTTCCCCTT CATAATAGAT TTGAAGCATG
GCCTGAAAAT TCAGAAAGAA AAAACGTATA CATGCAAACA TCATACTGTA GTAATTACCC ACAAAAAACA GTGTAAAAAT
ATGATCCTAT GTCTACTGCA AACATTATCT GTCTTATTTG TGCAGTGCAG ATATGGTCAT TAATTAATTT TAAATTAGTG
ATAACTAAAT GGTTTCTCTT ATATTGGCCA TCCCTTTTCC CATCAGTAAC AAAATGAACT ATCTCATACA TTAATACATA
TCATATTGTT CCAATTGCTA TTGCTACAGA CCTACTATAT CCTTCCTAAC AACAAGTTCC CCCTGTCCCC TCTAGCATTC
TTGCTAAATG ATTGGTTGAA CTATGGCTGA TAAGCCGTAG AAATATAAAA GAAGaaacca aaaatatttt gaactttttg
tctgtattat tcatggttta aaagccatgc tggaaaatag actgcaatga agaaaaacct caaaatcacc tataaaatta
tgtttcaaaa ttcaattttg gctatggatg ataaACCATC AAGCAGACAA TAAGAGTTAT TTACAATTGT TGCATTAAAC
TACTTGTGTC AGGATGACTC TTCTTCTCGG GCCTCCATCG TCTGGAAAAA GCACACTTAT GCGAGCACTA ACCGGCAAGC
CTGATAAAAA TCTCAAGGTT TTGATATTTC TTATTTAGTT TAATGTAGCC ACCTCTAACA GTAGAGTCGT ACCACATGAC
TAATCACTCG ATGGCTACAG GTGTCTGGCG AGATCACATA CTGTGGTCAT ACGTTTAAAG AGTTCTATCC TGAGAGGACT
AGTGCTTACG TCAGTCAGCA TGATCTGCAC AATCCTGAGA TGACAGTAAG AGAGACACTG GATTTCTCGA GACGATGCCT
TGGAAGTGGT GCCAGATATG ATATGCTGTC AGAATTAACA AGACGGGAAC GTAATGCAGG CATTAAACCT GACCCTGAGA
TTGATGCTTT GATGAAGGCA ACTGTAGTAG AAGGAAAACA GAACAATATT GTCACAGATC TTGTTCTGAA GGTAACACTG
TTTGACTTTT TACATGTTAA AAAATGGTTA TTTAGGCCTT CTAGCCTCAA TTATCCATCT GCTTCTTCTT TTTGTTGAAA
TATTAAAAGG AAGCTATGTG AGAATCTATT TTCTAGTACA CCTTTTTTAC AGGAAGTAAT ATACATGTAT GTATTTACTT
TGACTGTGAT ACACAAGTGA AACCTTAATA CTTCTGTTTA TGATGAAAAC TGAGTATGAA TTCTAAGTCA ATATTTGCTG
TGCTGATTGA GTTTATAAAT CTTCACAGGC GCTTGGACTG GACATTTGTG CCGATACTAT TGTTGGTGGT GCTATGATAA
GAGGCATTTC TGGTGGTCAA AAGAAACGTG TGACTACTGG TATGCATGCA TATGACATAC ATTAAATATA TCAGTAATTA
ATCATGTTCT CCATGAAATT TACTTCAATC ACTACATCAT AATCATAATA ATTATAACTT AAATAGGGAT AATGGATTTT
CTAACTGGAA AAGTTATTTG TCTCAAATCA TATTGTTCAG AAGTCAGTCG TGTTCCTTTT CTCCTGTGGA GCCTGGATTT
AGCCTTAGCC TTGTGGGGTC TACACCTTAG CCTTTTTTAT GCTAAATCGT TAGATTTATC AATATACTAT AACAGAATCC
AAGACTGAAA GACAACTCAG CCACTGTTTT CCTCTTTAAA CCTTTTACAC TAACCGGTAC CTAAAATTTT CTAGATAAAA
TGTTCATGAG ATCCTGGCAG GAACAAATTT TGTTCTTTTT CGTACATGGT CTTTTTTGTA CTCTAAGCTT GTCGTCTTGT
GCACATAGAC CATGTACAAA ATGGATCCCC ACTAGCCCAT GGACCTGTTG GGAACATGTT CGGAGTGGGC CTAACAGTAA
CGAGCAAGCA CATAGATCTA TTACTGTCGA TGCTTGGTGA ATGGTGATTG ATAGTAGAGT CATGTTGTAG TACTGATCAT
AAATATTGAT GGTCTTGTAA ATCAACGATA ATATTCAGCA TTCAATAATT TACAGCTGCA TGAGGAATCT TGATATTACA
TTACTGACAC ATTTACATCC TAAGATTGGA GTTCTGTCAT TGTTTTGTTG CAGGGGAGAT GCTCACTGGA CCAGCAACAG
CTTTGTTCAT GGATGAAATA TCTACTGGGC TTGATAGTTC TAGCACATTT CAGATTGTCA AATACATCAG ACAGGTGACC
CATGTGATGA ATGCTACAGT GATGATGTCT CTCCTACAGC CTCCACCTGA GACCTATGCT TTATTCGATG ACATCGTTCT
TATAGCAGAA GGTTACATAG TCTACCATGG ACCACGGGAG AACATACTTG AATTCTTTGA GAGTGCTGGT TTTCGGTGTC
CTGAACGGAA AGGAGTGGCC GACTTTCTTC AAGAGGTGAC TTCTAGGAAA GATCAACAGC AATACTGGTT CCTTGAGCAG
GATCATTATC GTTATGTGTC AGTCGAAGAG TTTGCTCAGA ATTTCAAGAA ATTTCATGTT GGGCAAAAGC TGCAGAAAGA
GCTTCAAGTT CCCTATGACA AATCTAAGAC ACATCCTGCT GCATTGACTA CCAAGAAGTA TGGGTTATCT AGTCTAGAGT
CCCTTAAGGC AGTGATGTCA AGAGAGTGGT TGCTAATGAA GCGGAATTCA TTCCTCTTCA TATTCAAGGC CTTTCAACTG
TTTGTCCTTG GATTTATAAC CATGACTCTG TTTTTGAGAA CAAAGATGCC CCACGAGAAA TTTTCTGATA CCTCTAAATA
TGTTGGTGCT TTAACTGCTT CTTTGATTAC AATCATGTTC AATGGTTTTG GTGAACTTCA ATTGACTATA GATAAACTCC
CGATATTCTA CAAACAAAGA GACTTCCTGT TCTTTCCAGC ATGGACCTAT GGACTTGCAA ACATCATTCT GAAGGTGCCT
TTATCCCTTA TGGAATCATC TCTTTGGATA GTTTTGACAT ATTATGTTGT GGGTTTTGCA CCTGCTGCAG GAAGGTAACT
TTTCTATTTT CTTTTGCTTT CCTAGGTATA TTATTTTTAA TATTTTCTAT AAACAGAATT TTCTACTAGT GATTGACTTG
ATGGGTTTGT CTGTGATCTG TCTACTGATT TCAGGTTCTT CAAGCAGTTT CTTGCATACT TTTGGACACA CCAGATGGCC
TTGGCCTTGT TCCGGTTGCT AGGTGCAATT TTAAGATCAA TGGTGGTAGC TAATACATTT GGCATGTTTG TGCTGCTACT
TATTTTCCTC TTTGGAGGAT TTCTCGTTTC CAGAAGTAAG TGTATTGTCG TTTGAAGTGT ATTTTAATTC TTTTGTCCAT
ATGATTAGTT AGAAGCATTG TGAAACCCTG GAAGATTCAT TATAACGTTT TCCCTAAGGT TTATATCTTA TTTTCTCTGA
ATATTCGAAA TATTCCAGTC TGAACTACTA ACTTATGTTT CTTATTTTCG TTTTTGACAT TTATGTTAAA AGAGGACATT
AAACCGTGGT GGATATGGGG CTACTGGACA TCTCCCATGA TGTATAGCAA TAATGCCTTA TCAGTTAATG AATTCCTTGC
CAGTAGGTGG GCCATTGTAA GTTTTCTGTC AACACAACCC TTTTCTTTCC AGAAGCATAG TATTTTCTTT GCATAGAAAA
AATAATTGGT TTCATTTGCA AGTCTAGATT TTTTTAGTAT ATATTCTCAA CATCAACTAA GTTTGATCGC CTCTAATTCC
TAGACATTTG ACAATATCAA CTTTTAACTG CAGCCAAACA ATGACTCAAG TATCAGTGCA CCAACAATAG GGAAGGCTTT
TCTTCAATCC AAAGGCTACT TCACAGGAGA ATGGGGGTAT TGGCTTTCCA TTGGAGCCAT GATAGGATTT ATGATTGTTT
TTAACATTCT CTACCTTTGT GCTCTTACAT TCCTAAGACG TAAGCACTTT TCCCTTACAT GGTATTGTCA CTTGTCTGTA
ATGCATGCCT TTAGCACTTA CACAATACTT CTACAGCTAT TGGCAGTGCA AGCACTGTTG TTTCTGATGA TGACACCAAA
AGTGAGCTCG AAGCAGAATC TAATCAGGAA CAAATGTCAG AGGTTATTAA TGGTAATACA GCAGTCAATG TGTCTCACAT
TTCATCATCG GTATTGTCCA TTCGTATCAA ATTGTTCTTG TTGTCGGCCC TGTTTGGATG AACATTCATC AGGAAGCTTA
CAGAAACAGA ACATCTATAT TGCTGGATGT TTGATTTATT ATGAGATTTT ATGAGAATTC AAATGGGTCC TGAATTGTGT
TATAGATGGA TTCTGCTACA AATTTCATAG CAGTTGATTC TAGCATCATG AAGCATGTTG TTTGTTTATT ATTTTAATGT
GTATTTGACA TCTCATAATT TATCCTGCAC CCACATCATT ATCTTAGGTA CGAATGGAAC AGAAAACAGA AGAAGCCAGA
GAGGAATGGT CTTGCCATTC CAGCCTCTTT CCCTTTCTTT CAACCATATG AACTACTACG TTGACATGCC TGCTGTAAGT
TGATATCCTA AAAATATATC CCAACTTACA TAACCATGTT TGCAAAGCTT ACGGGACAAA ACATACCTCA ATATCGTAAT
TAATTTCACT TTATTCTTCT TATAGATTAC TACTAGTTCT TGCAGTGATT TCTTTTTGCA ATTCAACATA GGAAGTTTGC
AAAGCTTACG GGACAAAACA TACCTCAATA TTGTAATTAA TTTCACTTTA TTCTTCTTAT AGATTACTAC TAGTTCTTGC
AGTGATTTCT TTTTGCAATT CAACATAGAA AGTTTGTAAT TCTACTTGCT TTACTTAGTT CTATTGTTCT ACAGAAATAT
GTAGTAGCTA TACGTTGTTG AAATTAACAA TGTCCTTTAT CATATAATCT AGATTGTCTG ACTGTTTTCC TTATTATATC
ATTGGATTGG TATCATACTG TACATAGTGA TTGTGATGGC ACGGGGTTCT CTTGTGTCCC CTGTTGCACT TAGATATTTA
ACTTTGTTAA GGATTAAATA TGTGTATTTT ATCTAGCTGA TAAATTACTA GTTGTCATTC ATTAACCATT TATTGAACTA
AGTTAGTAGT GATTTAATCT TGAATCAAGG GGTGCATTTC AAGTATGAAC TTGAAAATTT AAATTCTACC TTGTAGGAAA
TGAAAGCACA AGGATTCACA GAAAGCCGCC TCCAACTACT ATCTGATATT AGTGGTGCAT TCCGACCAGG TGTTCTAACA
GCACTAGTTG GTGTCAGTGG AGCTGGAAAA ACCACTCTAA TGGATGTACT GGCAGGAAGA AAGACTAGTG GAACGATTGA
GGGAGATATC AAGCTTTCTG GTTACCCTAA AAAACAAGAA ACCTTTGCTC GCATCAGTGG CTATTGTGAA CAAACTGATA
TACATTCACC AAATCTTACT GTATATGAAT CCATTGTTTA TTCTGCTTGG CTGCGCCTTT CCTCAGAAGT TGATAAGAAC
ACCAGGAAGG TATGTGTTCC TATTATTTTT GTGGTGGATG CCATTTAGTA AACTCAATAA CTCATGATGT TTCTTGGGGG
GAAATCAGAA AATCGTGTTA ATTGTAGTTG ATTGTGTGTA CTGTCCATTA ATTTAATCCA CTTATTGGTC ACTAATTATA
TATTATCACC TACCAAAAGA GGCCACACGA TTGTGTAGGC TTGTATATTA CCCGAATCTC GTCCACATGC AAGACACACT
TATTCGTTGA GTTCCTAGGA ACCTGACAGC ACACTAAACT GTCATTTGCC ATTTTTTATG AGTACTAACA AAATGACCAT
GCTTTGCTAT GGATAAAATA AAATATATTA TCATATGTAA TAGATAAAAA TATTTATTGa atatgttagt attcacttgt
ttcaaccaaa tatgtagact attccaaaat atcagaaaat atcaggggcc aatttgtaaa aactGTAAAC AGCGGTGGGG
TGCCACCACC AATAGAGACT TTTAAGGAGT ATACATATAC AAGGCATTTT TGACAATCAT GATATTGAAG AATAGATGCA
ACATTTTTTT ATCTTGTGAA GTTGAAAATA CTAATTATTT CTGATGAAAT TAATTCCACT GTGTAGGTGT TTGTGGAGGA
AGTGATGTCA CTAGTTGAGC TTGATGTATT GCGTGATGCT CTGGTTGGTC TCCCTGGTGT TAGTGGGTTG TCAACTGAAC
AAAGGAAGAG GCTGACAATC GCAGTAGAAC TAGTGGCAAA TCCTTCAATT ATCTTCATGG ATGAACCAAC TTCAGGTCTT
GATGCTAGAG CTGCAGCAAT TGTTATGCGT ACTGTGAGAA ATACAGTTAA CACAGGACGA ACTGTGGTTT GCACAATCCA
TCAACCTAGC ATTGATATCT TTGAGTCTTT TGATGAGGTC CTTGCTACTT TGCTCTTGTT TGTTTGTCCG TTAGTTCTCC
TTTCAGCGCT GTAAGGTTAT ACTGAAAAAT GGATTGTGTT TTTTCAGCTT CTGTTGCTAA AGAGGGGAGG ACGGGTTATA
TATGCTGGCC AGCTTGGTCT CCATTCACAA ATACTAGTCG AATATTTCGA GGTGAACTGT CTTTGATACT ATATTTCAGT
CTCTATGATA ACCAATTTGC AATATGTTAA CCATCTGTAT TGCTAAAATC AGTTAATACT TCTCATCTAT TGTGACCCAT
GAAATTCCAT TGGGCAAACT TGGATGGAAT TAGTAGCCCG AAGACATGCA TTTTTTTTAA TTAGTGAATG TATGAATACT
AGTTGGTAAT CTATCAACTA TTGAAGGTCG TTTAGGCCCT TTCTAGTGAT GCACAAATGT TCAGGCATAA ATTTCATTGT
CCATGACTGT ATCATTTTAG AACATGTGCA GTTAAAACCT TCCATCTTAA ATCAATAGCA TATGCAaata gacttttcac
gagaactact ttcatatagt tacatctttt taatgatttt tatatgatta caaaatgcaa ctatcaaaca tgtgcattgg
agactctgaa tgcagaagta aaaaataatg gagggagtaG AACACATTAT TGTTGGAACT CATAAATATT TTTTTCTATA
GTACTAAGGT TGATTCTTCA AAACTGCTTG TACAATTGTG CAACAAACTC TTTTTAATGA CATTGAGGCA AAGGGCAACT
ATACCACCTC AAAAACTAAT ATCTCAGATA AAAGTAATTT GTAATTGTAA AACTAAAAGA TATACAATTC TGTAGTCCCT
CTTTTTACAA ATGCTATTTC AGAATATGTG TAACCTGTAA TCTATTGTTT TGAGCAATAA TTAATAAAAC TTGAATACCA
ATATAAGTGC TTGGATCTAT CGCACGGAAA ACAATATTAG TGTATTTCTC ATCGACAGTA TTTATATACC GTTGTGTTTT
TTTATTTGCT AACATATAAT TAGAAAAGTA ACGTTCAAAT GTTTAGTGGA GACTATCTCA ATGCCTAGAA CAAATGTTTA
TTAAAAGAGC ATGGGGAACA TGCATGGAAT TAAGAGAACT TGGGTAACCG TATTCAATCC GAGACTAAAT AAGAAAGAAA
GAAAGGCTAC TTGCTTCTAA TGTATATCGT TCTCCTGCAG GCAATTCCAG GGGTCCCAAA AATCACAGAA GGATATAACC
CAGCAACATG GATGCTTGAA GTTAGCTCTT CTCTAGCTGA GGCTCGTCTG GACATAGACT TTGCTGAAGT TTATGCCAAT
TCTGCACTTT ACCGGTAAAT ATGTGCGCAA TATTATTCAA ATATTTAGTA GTACAATTTT TGTTGCTTTG ACAGTTGTGA
TTAATTTCTT CCAATGGTCA AACAGACAAA ATAAGTATCT TTTCTATAGC TCTTACATTA TTTCCGTCAA TGTGTTCAGG
AGCAATCAAG AACTTATTAA GCAGCTGAGT GTTCCACCTC CAGGCTTCCA GGATCTCTCA TTTCCTACCA AATATTCCCA
GAATTTCCTA AATCAGTGTG TGGCAAATAC ATGGAAGCAA TTTCAATCTT ATTGGAAGGA TCCACCCTAC AATGCTATGC
GTTATGTTAT GACGCTTCTC TATGGTCTTG TGTTTGGTAC TGTCTTTTGG CGGAGGGGAA AGAATATGTA TGTTCCTTCT
TCTTGTTCTA ATTTATATTC AAATTCTACC CATTCGCCTA TTCTTATTGC AACCATTTCA CTGAATGTAG TTTCACAGTG
ACACAACTCT ATTGCCTCTT AGCTGATCAT TTGAATTCTT TCCTATATGT ACAGAGAGTC CGTGAATGAT CTGAACAATC
TACTTGGAGC CACCTATGCT GCTGTTTTCT TCCTTGGAGC AGCAAATTTG CTCACACTTT TGCCTGTGGT GTCAGTTGAG
AGGACAGTCT TTTACCGTGA AAAGGCAGCA GGGATGTACT CTCCACTGTC TTATGCGTTT GCACAAGTAA GTTCTGAACA
CCCTTACAAG ATATGCTTAT GCATTTACCG ATGTACGATG AACAAGGTAT ATATGAGCCT TCCTCCAGCT AGAACCTCCC
AATTCAAAGC AGGCCAAAAA GAATGTTTTT TTTTTTTTGA AATGATGCCA AAAAGAATGT TAAGCAGCAG AGGACAAGTC
GCTTCCCTTC TCGTATTTGA CATAGTAGGA TAAGGAGGCA TGTTGAAAGA ATGTCATAAG GAGACATTTA AGAGATTGGA
TTTGATTGTC TGTCATCACA AATGCATTTG CGTTGGCCCT AAATATATGT GTACATCAGC ATAATCTGGA TTGTGAGGAA
AAACTCCCAA TAGTCTGATT TCAAGAGTAG AAGGGGCTCG GTATCCGGAT TCATAGTTTA GGGTGGGTGG TGGACTTTAG
TGATATTCAA CACAGCTAGT ATTCACACCT CTGGTTTTTG TAGCTGGACC TTTTATTTAG GCGAACTTTT AGAGTATGCG
CAGGATGCAT TTCATTGTTT ACATGTCAAC TGAAGTCTTA AAAATACCAA AATATCTACT GAAGCTTCTC CCAAAAACTG
AATGATGTGC ACAGGGATTT GTCGAGTTCT GCTACAGTGC AGTTCAAGGT GTTCTTTACA CTATCCTCAT CTATTCCATG
ATTGGCTATG AGTGGAAGGC GGACAAGTTC TTCTACTTCC TGTTCTTTAT GATTGCGGCC TTCGCCTACT TCACATTGTT
TAGCATGATG CTGGTTGCGT GCACTGCTTC GGAAATGCTT GCGGCCGTTC TTGTTTCATT TGTGCTCTCC TCGTGGAACA
ATTTTGCCGG ATTCATTATA CCCCGTCCAG TAAGTGCTTT CAATAAGAAG TGATGCTATC GGACTTACAT TATCTAGGCT
CTCAGCTTGT CATACATCTC TGAAATATTT TCTCTTGCAG CTGATTCCTG TTTGGTGGAG ATGGTTCTAT TGGGCCAACC
CGGTCTCCTG GACCATCTAT GGAGTGATTG CGTCGCAGTT TGCGGACAGC GACCGTGTTG TCACCGTTCC TGGCCAATCT
ACCACCATGG TGGTGAAGGA TTTCTTGGAG AAGAACATGG GCTTTAAGCA CGACTTCCTC GGCTACGTTG TGCTGGCTCA
TTTCGGCTAC GTCATCATCT TCTTCTTCCT CTTTGGATAC GGCATCAAGT GCTTGAACTT CCAGAAACGG TAGGAGGCCG
GTGTCCAGCA GGATGTCAAT CCGAGGTCAC GTTTTTGGAG TGTAAAGCAA ATGTAGCAAC TTAATACCGA TGCTTTTTTT
GTGTAGATAT ATAGTCTGTT CGATATCTGC TAGCTTGTAT TGACACTTAA TGTACAACAT TATTTACTCA AATGTTCTGA
GTTTATGGTA TATTATTCTT TTTCTATGTT A

Locus: Os07g0522500

Loading...

Locus: Os07g0522500

Loading...