Os07t0529600-01

Locus

Os07g0529600

Description

Thiamine synthase, Thiamine accumulation, Bacterial blight resistance, Blast resistance

RAP-DB Gene Symbol Synonym(s)

OsDR8, OsXNP

RAP-DB Gene Name Synonym(s)

defense-responsive gene 8, XopNKXO85 binding protein

CGSNL Gene Symbol

DR8

CGSNL Gene Name

PATHOGEN-INDUCED DEFENSE-RESPONSIVE PROTEIN 8

Oryzabase Gene Symbol Synonym(s)

OsDR8, OsXNP, FOXRED1

Oryzabase Gene Name Synonym(s)

pathogen-induced defense-responsive protein 8, defenseresponsive gene 8, XopNKXO85 binding protein, FAD dependent oxidoreductase 1, FAD dependent oxidoreductase domain containing protein 1, Defence-response protein 8

Transcript Evidence

AK099918

Protein Evidence

Q7XXS4

Literature

PMID: 24019919

PMID: 16514565

Note

Manual Curation

July 21, 2020

Gene Ontology (GO)

Biological Process: thiamine biosynthetic process (GO:0009228)

Functional domain (InterPro)

FAD/NAD(P)-binding domain superfamily (IPR036188)

Thiazole biosynthetic enzyme Thi4 family (IPR002922)

Thiamine thiazole synthase (IPR027495)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

Full-length cDNA

J013116J24 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0529600-01)

RiceXPro (AK099918)

Others

Oryzabase (6121)

KEGG (Os07t0529600-01)

Transcript

1411 bp

>Os07t0529600-01 Thiamine synthase, Thiamine accumulation, Bacterial blight resistance, Blast resistance
actcacacacactctcctcatcccagagcaagaagctcagctcctcctcctctcgcatgg
cagccatggccaccaccgcgtccagcctcctcaagacctccttcgctggcgcgcgcctcc
ccgccgccGCCCGCAACCCCACCGTCTCCGTCGCGCCGCGCACCGGCGGCGCCATCTGCA
ACTCCATCTCGTCGTCGTCGTCCACTCCCCCCTACGACCTCAACGCCATCAGGTTCAGCC
CCATCAAGGAGTCCATCGTGTCTCGCGAGATGACCCGGCGGTACATGACCGACATGATCA
CCTACGCCGACACCGACGTCGTCGTCGTCGGCGCCGGCTCCGCGGGGCTCTCCTGCGCGT
ACGAGCTCTCCAAGGACCCCTCCGTCAGCGTCGCCGTCATCGAGCAGTCGGTGTCCCCCG
GCGGCGGCGCGTGGCTCGGCGGGCAGCTGTTCTCCGCCATGGTGGTGCGCAAGCCGGCGC
ACCTGTTCCTCGACGAGCTCGGCGTCGCGTACGACGAGCAGGAGGACTACGTCGTCATCA
AGCACGCCGCGCTCTTCACCTCCACCGTCATGAGCCGCCTCCTGGCGCGCCCCAACGTGA
AGCTGTTCAACGCCGTCGCCGTCGAGGACCTCATCGTCAAGGAGGGCCGCGTCGGCGGCG
TGGTCACCAACTGGGCGCTGGTGTCGATGAACCACGACACGCAGTCGTGCATGGACCCCA
ACGTGATGGAGTCCAGGGTGGTGGTGAGCTCCTGCGGCCACGACGGGCCGTTCGGCGCCA
CGGGCGTCAAGCGGCTGCAGGACATCGGCATGATCGACGCCGTGCCCGGCATGCGCGCCC
TCGACATGAACACCGCCGAGGACGAGATCGTCCGCCTCACCCGCGAGGTCGTCCCCGGCA
TGATCGTCACCGGCATGGAGGTCGCCGAGATCGACGGCGCCCCGAGAATGGGCCCGACGT
TCGGAGCCATGATGATCTCCGGCCAGAAGGCGGCGCACCTGGCGCTGAAGGCGCTCGGCC
GGCCGAACGCCATCGACGGCACGATCAAGAAGGCGGCGGCGGCGGCGGCGCACCCGGAGC
TGATCCTGGCGTCGAAGGACGACGGCGAGATCGTGGACGCCTGAGCGAATAGAACAGGGT
AAAAAAAAATCCGCAAGACGTGGTGGTGACACGGAGGAGTTGGGGACGAGAAGAAGATGT
GGACTTTCCCCTGTGTTTTTTTTTCGGGATTTGCATTGATCCCCTTGTTTGTTTTAGCTC
TGGATGTTGATTAGCGTCTTGTTCATAGCACTTCCACTGCCACCGTGTGTGTGTGCTCTG
CTTGCCTGATGAGGGCAAGAAAACTTCCATGGATCCGTCTCTCTGGGAGGAATGAATAAA
AAGGATGAGGAAATAAAAATGATTCAGTGCC

CDS

1068 bp

>Os07t0529600-01 Thiamine synthase, Thiamine accumulation, Bacterial blight resistance, Blast resistance
atggcagccatggccaccaccgcgtccagcctcctcaagacctccttcgctggcgcgcgc
ctccccgccgccGCCCGCAACCCCACCGTCTCCGTCGCGCCGCGCACCGGCGGCGCCATC
TGCAACTCCATCTCGTCGTCGTCGTCCACTCCCCCCTACGACCTCAACGCCATCAGGTTC
AGCCCCATCAAGGAGTCCATCGTGTCTCGCGAGATGACCCGGCGGTACATGACCGACATG
ATCACCTACGCCGACACCGACGTCGTCGTCGTCGGCGCCGGCTCCGCGGGGCTCTCCTGC
GCGTACGAGCTCTCCAAGGACCCCTCCGTCAGCGTCGCCGTCATCGAGCAGTCGGTGTCC
CCCGGCGGCGGCGCGTGGCTCGGCGGGCAGCTGTTCTCCGCCATGGTGGTGCGCAAGCCG
GCGCACCTGTTCCTCGACGAGCTCGGCGTCGCGTACGACGAGCAGGAGGACTACGTCGTC
ATCAAGCACGCCGCGCTCTTCACCTCCACCGTCATGAGCCGCCTCCTGGCGCGCCCCAAC
GTGAAGCTGTTCAACGCCGTCGCCGTCGAGGACCTCATCGTCAAGGAGGGCCGCGTCGGC
GGCGTGGTCACCAACTGGGCGCTGGTGTCGATGAACCACGACACGCAGTCGTGCATGGAC
CCCAACGTGATGGAGTCCAGGGTGGTGGTGAGCTCCTGCGGCCACGACGGGCCGTTCGGC
GCCACGGGCGTCAAGCGGCTGCAGGACATCGGCATGATCGACGCCGTGCCCGGCATGCGC
GCCCTCGACATGAACACCGCCGAGGACGAGATCGTCCGCCTCACCCGCGAGGTCGTCCCC
GGCATGATCGTCACCGGCATGGAGGTCGCCGAGATCGACGGCGCCCCGAGAATGGGCCCG
ACGTTCGGAGCCATGATGATCTCCGGCCAGAAGGCGGCGCACCTGGCGCTGAAGGCGCTC
GGCCGGCCGAACGCCATCGACGGCACGATCAAGAAGGCGGCGGCGGCGGCGGCGCACCCG
GAGCTGATCCTGGCGTCGAAGGACGACGGCGAGATCGTGGACGCCTGA

Protein

356 aa

>Os07t0529600-01 Thiamine synthase, Thiamine accumulation, Bacterial blight resistance, Blast resistance
MAAMATTASSLLKTSFAGARLPAAARNPTVSVAPRTGGAICNSISSSSSTPPYDLNAIRF
SPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVSVAVIEQSVS
PGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTVMSRLLARPN
VKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMESRVVVSSCGHDGPFG
ATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGP
TFGAMMISGQKAAHLALKALGRPNAIDGTIKKAAAAAAHPELILASKDDGEIVDA*

5'UTR

chr07:20724581..20724636 (+ strand) : 56 bp

CDS

chr07:20724637..20725530 (+ strand) : 894 bp

chr07:20725609..20725782 (+ strand) : 174 bp

3'UTR

chr07:20725783..20726069 (+ strand) : 287 bp

FASTA

>Os07t0529600-01 class=Sequence position=chr07:20724581..20726069 (+ strand)
actcacacac actctcctca tcccagagca agaagctcag ctcctcctcc tctcgcatgg cagccatggc caccaccgcg
tccagcctcc tcaagacctc cttcgctggc gcgcgcctcc ccgccgccGC CCGCAACCCC ACCGTCTCCG TCGCGCCGCG
CACCGGCGGC GCCATCTGCA ACTCCATCTC GTCGTCGTCG TCCACTCCCC CCTACGACCT CAACGCCATC AGGTTCAGCC
CCATCAAGGA GTCCATCGTG TCTCGCGAGA TGACCCGGCG GTACATGACC GACATGATCA CCTACGCCGA CACCGACGTC
GTCGTCGTCG GCGCCGGCTC CGCGGGGCTC TCCTGCGCGT ACGAGCTCTC CAAGGACCCC TCCGTCAGCG TCGCCGTCAT
CGAGCAGTCG GTGTCCCCCG GCGGCGGCGC GTGGCTCGGC GGGCAGCTGT TCTCCGCCAT GGTGGTGCGC AAGCCGGCGC
ACCTGTTCCT CGACGAGCTC GGCGTCGCGT ACGACGAGCA GGAGGACTAC GTCGTCATCA AGCACGCCGC GCTCTTCACC
TCCACCGTCA TGAGCCGCCT CCTGGCGCGC CCCAACGTGA AGCTGTTCAA CGCCGTCGCC GTCGAGGACC TCATCGTCAA
GGAGGGCCGC GTCGGCGGCG TGGTCACCAA CTGGGCGCTG GTGTCGATGA ACCACGACAC GCAGTCGTGC ATGGACCCCA
ACGTGATGGA GTCCAGGGTG GTGGTGAGCT CCTGCGGCCA CGACGGGCCG TTCGGCGCCA CGGGCGTCAA GCGGCTGCAG
GACATCGGCA TGATCGACGC CGTGCCCGGC ATGCGCGCCC TCGACATGAA CACCGCCGAG GACGAGATCG TCCGCCTCAC
CCGCGAGGTC GTCCCCGGCA TGATCGTCAC CGGCATGGAG GTCGCCGAGA TCGACGGCGC CCCGAGAATG GTACGCACCA
AAAAAACATC AAACTCTTCA CCATAATCTC TCCCCCGTTC TTGGATTTGA ACAAATTCGT TGTTGCAGGG CCCGACGTTC
GGAGCCATGA TGATCTCCGG CCAGAAGGCG GCGCACCTGG CGCTGAAGGC GCTCGGCCGG CCGAACGCCA TCGACGGCAC
GATCAAGAAG GCGGCGGCGG CGGCGGCGCA CCCGGAGCTG ATCCTGGCGT CGAAGGACGA CGGCGAGATC GTGGACGCCT
GAGCGAATAG AACAGGGTAA AAAAAAATCC GCAAGACGTG GTGGTGACAC GGAGGAGTTG GGGACGAGAA GAAGATGTGG
ACTTTCCCCT GTGTTTTTTT TTCGGGATTT GCATTGATCC CCTTGTTTGT TTTAGCTCTG GATGTTGATT AGCGTCTTGT
TCATAGCACT TCCACTGCCA CCGTGTGTGT GTGCTCTGCT TGCCTGATGA GGGCAAGAAA ACTTCCATGG ATCCGTCTCT
CTGGGAGGAA TGAATAAAAA GGATGAGGAA ATAAAAATGA TTCAGTGCC

Locus: Os07g0529600

Loading...

Locus: Os07g0529600

Loading...