Os07t0529600-02

Locus

Os07g0529600

Description

Similar to Pathogen-induced defense-responsive protein 8.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DR8

CGSNL Gene Name

PATHOGEN-INDUCED DEFENSE-RESPONSIVE PROTEIN 8

Oryzabase Gene Symbol Synonym(s)

OsDR8, OsXNP, FOXRED1

Oryzabase Gene Name Synonym(s)

pathogen-induced defense-responsive protein 8, defenseresponsive gene 8, XopNKXO85 binding protein, FAD dependent oxidoreductase 1, FAD dependent oxidoreductase domain containing protein 1, Defence-response protein 8

Transcript Evidence

AK064916 (DDBJ, Best hit)

Protein Evidence

Q20IJ5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: thiamine biosynthetic process (GO:0009228)

Functional domain (InterPro)

Thiamine biosynthesis Thi4 protein (IPR002922)

Full-length cDNA

J013000M17 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0529600-02)

RiceXPro (AK064916)

Others

Oryzabase (6121)

KEGG (Os07t0529600-02)

Transcript

1489 bp

>Os07t0529600-02 Similar to Pathogen-induced defense-responsive protein 8.
actcacacacactctcctcatcccagagcaagaagctcagctcctcctcctctcgcatgg
cagccatggccaccaccgcgtccagcctcctcaagacctccttcgctggcgcgcgcctcc
ccgccgccGCCCGCAACCCCACCGTCTCCGTCGCGCCGCGCACCGGCGGCGCCATCTGCA
ACTCCATCTCGTCGTCGTCGTCCACTCCCCCCTACGACCTCAACGCCATCAGGTTCAGCC
CCATCAAGGAGTCCATCGTGTCTCGCGAGATGACCCGGCGGTACATGACCGACATGATCA
CCTACGCCGACACCGACGTCGTCGTCGTCGGCGCCGGCTCCGCGGGGCTCTCCTGCGCGT
ACGAGCTCTCCAAGGACCCCTCCGTCAGCGTCGCCGTCATCGAGCAGTCGGTGTCCCCCG
GCGGCGGCGCGTGGCTCGGCGGGCAGCTGTTCTCCGCCATGGTGGTGCGCAAGCCGGCGC
ACCTGTTCCTCGACGAGCTCGGCGTCGCGTACGACGAGCAGGAGGACTACGTCGTCATCA
AGCACGCCGCGCTCTTCACCTCCACCGTCATGAGCCGCCTCCTGGCGCGCCCCAACGTGA
AGCTGTTCAACGCCGTCGCCGTCGAGGACCTCATCGTCAAGGAGGGCCGCGTCGGCGGCG
TGGTCACCAACTGGGCGCTGGTGTCGATGAACCACGACACGCAGTCGTGCATGGACCCCA
ACGTGATGGAGTCCAGGGTGGTGGTGAGCTCCTGCGGCCACGACGGGCCGTTCGGCGCCA
CGGGCGTCAAGCGGCTGCAGGACATCGGCATGATCGACGCCGTGCCCGGCATGCGCGCCC
TCGACATGAACACCGCCGAGGACGAGATCGTCCGCCTCACCCGCGAGGTCGTCCCCGGCA
TGATCGTCACCGGCATGGAGGTCGCCGAGATCGACGGCGCCCCGAGAATGGTACGCACCA
AAAAAACATCAAACTCTTCACCATAATCTCTCCCCCGTTCTTGGATTTGAACAAATTCGT
TGTTGCAGGGCCCGACGTTCGGAGCCATGATGATCTCCGGCCAGAAGGCGGCGCACCTGG
CGCTGAAGGCGCTCGGCCGGCCGAACGCCATCGACGGCACGATCAAGAAGGCGGCGGCGG
CGGCGGCGCACCCGGAGCTGATCCTGGCGTCGAAGGACGACGGCGAGATCGTGGACGCCT
GAGCGAATAGAACAGGGTAAAAAAAAATCCGCAAGACGTGGTGGTGACACGGAGGAGTTG
GGGACGAGAAGAAGATGTGGACTTTCCCCTGTGTTTTTTTTTCGGGATTTGCATTGATCC
CCTTGTTTGTTTTAGCTCTGGATGTTGATTAGCGTCTTGTTCATAGCACTTCCACTGCCA
CCGTGTGTGTGTGCTCTGCTTGCCTGATGAGGGCAAGAAAACTTCCATGGATCCGTCTCT
CTGGGAGGAATGAATAAAAAGGATGAGGAAATAAAAATGATTCAGTGCC

CDS

930 bp

>Os07t0529600-02 Similar to Pathogen-induced defense-responsive protein 8.
atggcagccatggccaccaccgcgtccagcctcctcaagacctccttcgctggcgcgcgc
ctccccgccgccGCCCGCAACCCCACCGTCTCCGTCGCGCCGCGCACCGGCGGCGCCATC
TGCAACTCCATCTCGTCGTCGTCGTCCACTCCCCCCTACGACCTCAACGCCATCAGGTTC
AGCCCCATCAAGGAGTCCATCGTGTCTCGCGAGATGACCCGGCGGTACATGACCGACATG
ATCACCTACGCCGACACCGACGTCGTCGTCGTCGGCGCCGGCTCCGCGGGGCTCTCCTGC
GCGTACGAGCTCTCCAAGGACCCCTCCGTCAGCGTCGCCGTCATCGAGCAGTCGGTGTCC
CCCGGCGGCGGCGCGTGGCTCGGCGGGCAGCTGTTCTCCGCCATGGTGGTGCGCAAGCCG
GCGCACCTGTTCCTCGACGAGCTCGGCGTCGCGTACGACGAGCAGGAGGACTACGTCGTC
ATCAAGCACGCCGCGCTCTTCACCTCCACCGTCATGAGCCGCCTCCTGGCGCGCCCCAAC
GTGAAGCTGTTCAACGCCGTCGCCGTCGAGGACCTCATCGTCAAGGAGGGCCGCGTCGGC
GGCGTGGTCACCAACTGGGCGCTGGTGTCGATGAACCACGACACGCAGTCGTGCATGGAC
CCCAACGTGATGGAGTCCAGGGTGGTGGTGAGCTCCTGCGGCCACGACGGGCCGTTCGGC
GCCACGGGCGTCAAGCGGCTGCAGGACATCGGCATGATCGACGCCGTGCCCGGCATGCGC
GCCCTCGACATGAACACCGCCGAGGACGAGATCGTCCGCCTCACCCGCGAGGTCGTCCCC
GGCATGATCGTCACCGGCATGGAGGTCGCCGAGATCGACGGCGCCCCGAGAATGGTACGC
ACCAAAAAAACATCAAACTCTTCACCATAA

Protein

310 aa

>Os07t0529600-02 Similar to Pathogen-induced defense-responsive protein 8.
MAAMATTASSLLKTSFAGARLPAAARNPTVSVAPRTGGAICNSISSSSSTPPYDLNAIRF
SPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVSVAVIEQSVS
PGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTVMSRLLARPN
VKLFNAVAVEDLIVKEGRVGGVVTNWALVSMNHDTQSCMDPNVMESRVVVSSCGHDGPFG
ATGVKRLQDIGMIDAVPGMRALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMVR
TKKTSNSSP*

5'UTR

chr07:20724581..20724636 (+ strand) : 56 bp

CDS

chr07:20724637..20725566 (+ strand) : 930 bp

3'UTR

chr07:20725567..20726069 (+ strand) : 503 bp

FASTA

>Os07t0529600-02 class=Sequence position=chr07:20724581..20726069 (+ strand)
actcacacac actctcctca tcccagagca agaagctcag ctcctcctcc tctcgcatgg cagccatggc caccaccgcg
tccagcctcc tcaagacctc cttcgctggc gcgcgcctcc ccgccgccGC CCGCAACCCC ACCGTCTCCG TCGCGCCGCG
CACCGGCGGC GCCATCTGCA ACTCCATCTC GTCGTCGTCG TCCACTCCCC CCTACGACCT CAACGCCATC AGGTTCAGCC
CCATCAAGGA GTCCATCGTG TCTCGCGAGA TGACCCGGCG GTACATGACC GACATGATCA CCTACGCCGA CACCGACGTC
GTCGTCGTCG GCGCCGGCTC CGCGGGGCTC TCCTGCGCGT ACGAGCTCTC CAAGGACCCC TCCGTCAGCG TCGCCGTCAT
CGAGCAGTCG GTGTCCCCCG GCGGCGGCGC GTGGCTCGGC GGGCAGCTGT TCTCCGCCAT GGTGGTGCGC AAGCCGGCGC
ACCTGTTCCT CGACGAGCTC GGCGTCGCGT ACGACGAGCA GGAGGACTAC GTCGTCATCA AGCACGCCGC GCTCTTCACC
TCCACCGTCA TGAGCCGCCT CCTGGCGCGC CCCAACGTGA AGCTGTTCAA CGCCGTCGCC GTCGAGGACC TCATCGTCAA
GGAGGGCCGC GTCGGCGGCG TGGTCACCAA CTGGGCGCTG GTGTCGATGA ACCACGACAC GCAGTCGTGC ATGGACCCCA
ACGTGATGGA GTCCAGGGTG GTGGTGAGCT CCTGCGGCCA CGACGGGCCG TTCGGCGCCA CGGGCGTCAA GCGGCTGCAG
GACATCGGCA TGATCGACGC CGTGCCCGGC ATGCGCGCCC TCGACATGAA CACCGCCGAG GACGAGATCG TCCGCCTCAC
CCGCGAGGTC GTCCCCGGCA TGATCGTCAC CGGCATGGAG GTCGCCGAGA TCGACGGCGC CCCGAGAATG GTACGCACCA
AAAAAACATC AAACTCTTCA CCATAATCTC TCCCCCGTTC TTGGATTTGA ACAAATTCGT TGTTGCAGGG CCCGACGTTC
GGAGCCATGA TGATCTCCGG CCAGAAGGCG GCGCACCTGG CGCTGAAGGC GCTCGGCCGG CCGAACGCCA TCGACGGCAC
GATCAAGAAG GCGGCGGCGG CGGCGGCGCA CCCGGAGCTG ATCCTGGCGT CGAAGGACGA CGGCGAGATC GTGGACGCCT
GAGCGAATAG AACAGGGTAA AAAAAAATCC GCAAGACGTG GTGGTGACAC GGAGGAGTTG GGGACGAGAA GAAGATGTGG
ACTTTCCCCT GTGTTTTTTT TTCGGGATTT GCATTGATCC CCTTGTTTGT TTTAGCTCTG GATGTTGATT AGCGTCTTGT
TCATAGCACT TCCACTGCCA CCGTGTGTGT GTGCTCTGCT TGCCTGATGA GGGCAAGAAA ACTTCCATGG ATCCGTCTCT
CTGGGAGGAA TGAATAAAAA GGATGAGGAA ATAAAAATGA TTCAGTGCC

Locus: Os07g0529600

Loading...

Locus: Os07g0529600

Loading...