Os07t0556000-01

Locus

Os07g0556000

Description

Cyclin D domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYCD6;1

CGSNL Gene Name

CYCLIN-D6-1

Oryzabase Gene Symbol Synonym(s)

CycD6;1, CycD6;os;1, Orysa;CycD6;1, Orysa;CYCD6;1, OsCYCD6;1

Oryzabase Gene Name Synonym(s)

D-type cyclin 6;1

Transcript Evidence

AK121938 (DDBJ, Best hit)

Protein Evidence

Q69S43 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Cyclin, N-terminal (IPR006671)

Cyclin-like (IPR013763)

Full-length cDNA

J033107C14 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0556000-01)

RiceXPro (AK121938)

Others

Oryzabase (13272)

KEGG (Os07t0556000-01)

Transcript

1440 bp

>Os07t0556000-01 Cyclin D domain containing protein.
AGTAGCACTGCGTAGCAGCAATGGTGGCTTCCTCCTCCTCCTCCTCCTCCTCCTCTCCCT
CTCCCCCATAAAGCCACGCACCACGCGCGGTTGGTTTCTTGGCGTGTTCCTGGGCCTTCC
TCGTACTACGCGGCGGCGGGCGGCGGCCATGGACATGGCGACGGGGGCGAAGGAGGTGGT
GGTGGTGGAGGCGTACGAGTACGAGTTCGACCTCGAGAACCCGTTCACCAGCCCCGCCGA
CGAGCCGATCGCCAGCCTCCTCGACGCCGAGGGCCACCACTCGCCGTCCGTCTCCGCCGC
CGCCTCCGCCGCCCGCCGCGAGGCCGCCGGGTTCATCTCCAAGGTGCGGTACGACGGCGA
GCTGGACGTGCACCCCCGCGTCGCCTACCTCGCGCTCAACTACGTAGATCGCTACCTCTC
CAAGCGCCAATTGGCCTGCGAGCGCAACCCATGGGCGCCGCGGCTGCTCGCCATCAGCTG
CCTCACCCTCGCCGCCAAGATGCAGCGCGCCGCCGCCATCTCCGCCGCCGACATCCAGAG
GGGCGAGGAGTTCATGttcgacgaggcgaaaatccagcgcatggagcagatggtgctcaa
cgcgctggagtggcggacgcgctccgtcacgccgctcgccttcctcggcttctttctctc
cgcgtgcttcccgcagccgcggcacccggcgctgctcgacgccatcaaggccCGCGCCGT
CGACCTCCTCCTCCGCGTCCAGCCGGAGGTGAAGATGGCGGAGTTCTCCCCCTCCGTGGC
GGCCGCCGCGGCCCTCCTCGCGGCCGCCGGAGAGGTCGCCGGCGCCCACCTCCTCGGCTT
CGAAGCTGGCGTCGCCGCTTGCCCCTTTGTAAATAGCGAGAAGTTGCGGGAGTGCGGCGA
GGTGATGGCGGCGGCCTGCGGCGTCGGGCCCAGCTGGGCGGCGGCGGCGACGAGCGCCGA
GACGCCGGTGACGGTGCTCGGCCACCACCGGAGCGCGAGCTCCGAGAGCGAGCGCACCAC
CACCGTCGGATCGGCGGCCAACAGCGCCGATGCGAAGAGGCGCTGCATGGGCCCACCTCG
GCAGTGGGGGGTAGGCGGCCCTGATGAGTGATGAGGCAACGTGAGCGAGAGATAGGGTGA
CGACTCGGACGACAGCTGGAAGAGCTGGAAATTTGCTCTTGCCCTGCTCTTTCTTTCATT
CACCTTTCCTTTTCTTTCCGATTCTTTTTTCCCTCTATTTTAATCTTTTCGAGGTAAAGC
AGGAATGGAGATAATTGGTGGTGGTAGCTGTCATTTTAATTGCTTTTTTTGCTCGTCTTT
TTTTAGGCTAGTTTTGTTTTTGTTCAGAAGTACTGGATGTTAAGGGCGATGAATATATTG
TGGTGAGAGGGAGAGGGGGATAATGTGATATTGCGGAAAATAAAAAAAATGTTGTTGCTC

CDS

963 bp

>Os07t0556000-01 Cyclin D domain containing protein.
ATGGACATGGCGACGGGGGCGAAGGAGGTGGTGGTGGTGGAGGCGTACGAGTACGAGTTC
GACCTCGAGAACCCGTTCACCAGCCCCGCCGACGAGCCGATCGCCAGCCTCCTCGACGCC
GAGGGCCACCACTCGCCGTCCGTCTCCGCCGCCGCCTCCGCCGCCCGCCGCGAGGCCGCC
GGGTTCATCTCCAAGGTGCGGTACGACGGCGAGCTGGACGTGCACCCCCGCGTCGCCTAC
CTCGCGCTCAACTACGTAGATCGCTACCTCTCCAAGCGCCAATTGGCCTGCGAGCGCAAC
CCATGGGCGCCGCGGCTGCTCGCCATCAGCTGCCTCACCCTCGCCGCCAAGATGCAGCGC
GCCGCCGCCATCTCCGCCGCCGACATCCAGAGGGGCGAGGAGTTCATGttcgacgaggcg
aaaatccagcgcatggagcagatggtgctcaacgcgctggagtggcggacgcgctccgtc
acgccgctcgccttcctcggcttctttctctccgcgtgcttcccgcagccgcggcacccg
gcgctgctcgacgccatcaaggccCGCGCCGTCGACCTCCTCCTCCGCGTCCAGCCGGAG
GTGAAGATGGCGGAGTTCTCCCCCTCCGTGGCGGCCGCCGCGGCCCTCCTCGCGGCCGCC
GGAGAGGTCGCCGGCGCCCACCTCCTCGGCTTCGAAGCTGGCGTCGCCGCTTGCCCCTTT
GTAAATAGCGAGAAGTTGCGGGAGTGCGGCGAGGTGATGGCGGCGGCCTGCGGCGTCGGG
CCCAGCTGGGCGGCGGCGGCGACGAGCGCCGAGACGCCGGTGACGGTGCTCGGCCACCAC
CGGAGCGCGAGCTCCGAGAGCGAGCGCACCACCACCGTCGGATCGGCGGCCAACAGCGCC
GATGCGAAGAGGCGCTGCATGGGCCCACCTCGGCAGTGGGGGGTAGGCGGCCCTGATGAG
TGA

Protein

321 aa

>Os07t0556000-01 Cyclin D domain containing protein.
MDMATGAKEVVVVEAYEYEFDLENPFTSPADEPIASLLDAEGHHSPSVSAAASAARREAA
GFISKVRYDGELDVHPRVAYLALNYVDRYLSKRQLACERNPWAPRLLAISCLTLAAKMQR
AAAISAADIQRGEEFMFDEAKIQRMEQMVLNALEWRTRSVTPLAFLGFFLSACFPQPRHP
ALLDAIKARAVDLLLRVQPEVKMAEFSPSVAAAAALLAAAGEVAGAHLLGFEAGVAACPF
VNSEKLRECGEVMAAACGVGPSWAAAATSAETPVTVLGHHRSASSESERTTTVGSAANSA
DAKRRCMGPPRQWGVGGPDE*

5'UTR

chr07:22171576..22171723 (- strand) : 148 bp

CDS

chr07:22171381..22171575 (- strand) : 195 bp

chr07:22171178..22171270 (- strand) : 93 bp

chr07:22170986..22171087 (- strand) : 102 bp

chr07:22170663..22170870 (- strand) : 208 bp

chr07:22170442..22170572 (- strand) : 131 bp

chr07:22169851..22170084 (- strand) : 234 bp

3'UTR

chr07:22169522..22169850 (- strand) : 329 bp

FASTA

>Os07t0556000-01 class=Sequence position=chr07:22169522..22171723 (- strand)
AGTAGCACTG CGTAGCAGCA ATGGTGGCTT CCTCCTCCTC CTCCTCCTCC TCCTCTCCCT CTCCCCCATA AAGCCACGCA
CCACGCGCGG TTGGTTTCTT GGCGTGTTCC TGGGCCTTCC TCGTACTACG CGGCGGCGGG CGGCGGCCAT GGACATGGCG
ACGGGGGCGA AGGAGGTGGT GGTGGTGGAG GCGTACGAGT ACGAGTTCGA CCTCGAGAAC CCGTTCACCA GCCCCGCCGA
CGAGCCGATC GCCAGCCTCC TCGACGCCGA GGGCCACCAC TCGCCGTCCG TCTCCGCCGC CGCCTCCGCC GCCCGCCGCG
AGGCCGCCGG GTTCATCTCC AAGGTATCCG GGACGCGTTC TCCTCTTGGG TTTGTTTCCT TGGGGGGGTT CTTCGAGGTT
CTTTCCCCTG TTTTCTTGAT CTGATCGGGC GTGTTTTTGA TCGGCGCGCC CAGGTGCGGT ACGACGGCGA GCTGGACGTG
CACCCCCGCG TCGCCTACCT CGCGCTCAAC TACGTAGATC GCTACCTCTC CAAGCGCCAA TTGGCCGTAA GAACGCGTGA
TACGGGGGCT CTTTTCTCTG GCTGGATTTT GTGCAGGGAT TCGCTTCTGA TCTGATTCCC CAATGGTTCC GTGCAGTGCG
AGCGCAACCC ATGGGCGCCG CGGCTGCTCG CCATCAGCTG CCTCACCCTC GCCGCCAAGA TGCAGCGCGC CGCCGCCATC
TCCGCCGCCG ACATCCAGGT ACGGGACGAA TGCCATTTCC CGTTGCGCGG TTGCGATTTC GTTGGGGGGG GGGATTCGTC
CATCCGATTT GCTGAAACCT CGTGTCGTTG GTGTGGGCGT CGGTCTGTTG CAGAGGGGCG AGGAGTTCAT Gttcgacgag
gcgaaaatcc agcgcatgga gcagatggtg ctcaacgcgc tggagtggcg gacgcgctcc gtcacgccgc tcgccttcct
cggcttcttt ctctccgcgt gcttcccgca gccgcggcac ccggcgctgc tcgacgccat caaggccCGC GCCGTCGACC
TCCTCCTCCG CGTCCAGCCG GGTACGTCCA AGCCGCCGCC ACGCCCAATG CCACCGTCCT CGCCGTTAGA TTCAGCGAGC
GCTCACCTTT TGCCTCCGGT GCATTTCGCA GAGGTGAAGA TGGCGGAGTT CTCCCCCTCC GTGGCGGCCG CCGCGGCCCT
CCTCGCGGCC GCCGGAGAGG TCGCCGGCGC CCACCTCCTC GGCTTCGAAG CTGGCGTCGC CGCTTGCCCC TTTGTAAATA
GCGTGAGCAT GATTCTTTTT TTTTTAATAA ATTTTGTTTC ATCTAAAATT ACCCCCTTAA TCACCACTTA TTTACGAAAC
AACCCCTGTC ACGTCTGACA CAGTCACACA TAGCCCGGCT CTCTGTGAGA GGCGACTTTT GGAGTAAAAA AAAAATACTG
TTTACGTTTT AAAAAATGAT TTACCTCGTG ATATGGAGCA AGCTCAGCCA ATTGACCGCA CTGTAAAAAC TTTGGTTGTT
TTCTCATTTG TGGAGTTAAT TAATCATACC TTAATTGTCA CATAATTAGA ACCACTCATA ATGCCCCCCG TGGCCTGGAA
GCTGGCTATA ATCATTTTGC TTGGACTTTT CTGCTGCAGG AGAAGTTGCG GGAGTGCGGC GAGGTGATGG CGGCGGCCTG
CGGCGTCGGG CCCAGCTGGG CGGCGGCGGC GACGAGCGCC GAGACGCCGG TGACGGTGCT CGGCCACCAC CGGAGCGCGA
GCTCCGAGAG CGAGCGCACC ACCACCGTCG GATCGGCGGC CAACAGCGCC GATGCGAAGA GGCGCTGCAT GGGCCCACCT
CGGCAGTGGG GGGTAGGCGG CCCTGATGAG TGATGAGGCA ACGTGAGCGA GAGATAGGGT GACGACTCGG ACGACAGCTG
GAAGAGCTGG AAATTTGCTC TTGCCCTGCT CTTTCTTTCA TTCACCTTTC CTTTTCTTTC CGATTCTTTT TTCCCTCTAT
TTTAATCTTT TCGAGGTAAA GCAGGAATGG AGATAATTGG TGGTGGTAGC TGTCATTTTA ATTGCTTTTT TTGCTCGTCT
TTTTTTAGGC TAGTTTTGTT TTTGTTCAGA AGTACTGGAT GTTAAGGGCG ATGAATATAT TGTGGTGAGA GGGAGAGGGG
GATAATGTGA TATTGCGGAA AATAAAAAAA ATGTTGTTGC TC

Locus: Os07g0556000

Loading...

Locus: Os07g0556000

Loading...