Os07t0565600-01

Locus

Os07g0565600

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP37

CGSNL Gene Name

CYCLOPHILIN 37

Oryzabase Gene Symbol Synonym(s)

OsCYP37, OsCYP37a, OsCYP37b

Oryzabase Gene Name Synonym(s)

cyclophilin 37

Transcript Evidence

AK107481 (DDBJ, Best hit)

Protein Evidence

XP_002885091.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

002-129-C02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0565600-01)

RiceXPro (AK107481)

Others

Oryzabase (10068)

KEGG (Os07t0565600-01)

Transcript

1716 bp

>Os07t0565600-01 Similar to predicted protein.
AGCTCACTGGCTGGGGATAGACGAGACGGCGACCACGACGATGACGATGACGACGACGAC
GGCGACGGCAGCAACGGCATCCCCACCACCACCCCCATCTCCGGTTCCTCCCCTCCCCGC
GTCTCAACCCACCGGAAATCCATTCAAAAGCACCCGCGCTCCCGCACCAATCCACCGCAC
GCCATGGCGTCGCGAGCGGCGGCCGCGATGGTGCTCGCCGGTGCCCTTCCTGTGTTTCCC
GGCCGTCCCCTGGTCGCAGCCGGCGCCAGGTGCTGCGACGGCGGCATTCGCGGGAGGGTC
TCCTGCTCCTCCCACCGTCGCTCGGACCATCCCTCCTGCGCGGCTGAGGTGAGCACGCGC
TGGTTGCTGGTCTCTCCTCATCCAAATGGCTTCCAAAGCTGTAGCGTTCGCTTCAGTTTA
ATCGTGTGGTTGTCTGGTTTGGTGCAGGAGGGAGGAGTGGTGGAGCTGCTCAAGGGCGCG
GTCGCGGCGCTCGCCGTCATCGCCCAGATTTCCGTGTCGCTCCCGGCGGACGCGATCCTC
TACTCGCCGGACACGAACGTGCCGAGGACGGGGGAGCTGGCGCTGAGGAGGGCCATCCCC
GCGAACCCAAACATGAAGACCATACAGGAATCGCTGGAGGACATTTCGTATTTGCTGAGG
ATACCGCAGAGGAAGCCGTATGGCTCCATGGAAGGAGACGTAAAAAAGGCCATGAAGATA
GCAATGGACAACAAGGATGCGATCTTGGCAAGTATACCTGTAGAACTCAAGGAAAAGGGC
TCGAAGTTATATACCTCCTTGCTTGAAGAGAAGGGTGGTTTGCAAACTCTCTTGAAATAT
ATAAAGGAAAATGATCCTGACAGACTTTCGGTTGCACTTGCTTCTTCTCTTGATACTGTT
GCTGAATTGGAGCTGTTACAGGCTCCAGGTTTATCCTTCCTCTTACCACAACAATATTTG
GAATATCCAAGGCTAGCAGGAAGAGGAGTTGTTGAATTCTCAGTGGAGAAAGGTGATGGT
TCAACATTCTTTCCAACTGCTGGTGGTGAACCAAAAAGTGTTGCTACAATTCAGGTAGTG
ATTGATGGATATTCTGCCCCACTGACTGCTGGAAACTTTGCGAAATTGGTGTTGGATGGG
GCATATGATGGGATAAAACTGAAATGTGCAAGTCAGGCAATTATTGCAGACAACGAGAAT
GGAAAGAAAGGTTACACTGTTCCATTAGAGGTCATGCCTGCTGGGCAGTTTGAACCGTTA
TACAGAACTCCGCTAAGTATTCAGGATGGAGAATTGCCAGTCCTTCCGATGTCTGTATAT
GGTGCCGTTGCTATGGCCCATAGTGTGGATTCTGATGAATACTCGTCACCAAGCCAATTC
TTCTTCTATCTGTATGACAAGAGAAATTCTGGTTTAGGAGGAATATCTTTTGATGAAGGG
CAATTCTCAGTATTCGGGTATACCACAGATGGAAGAGAAGTTCTGTCGCAGATTAAAACT
GGAGATATAATTCGTTCTGCCAAGCTTGTACAAGGTAGAGAGCGCCTTGTACTGCCTCCA
GAAGCGCCGGCAGAGAGCTGATACAACGGCAAGCTTCGCAAACTGGAAACATTCTTTCAT
TGGTCAGGAGACTTAGCATATTTTATACCATAAATCATGTAAACCTGACTGAGCAGTTCA
TCAAATTTATATATAGAATCACTGCAAATGTTCATC

CDS

1398 bp

>Os07t0565600-01 Similar to predicted protein.
ATGGCGTCGCGAGCGGCGGCCGCGATGGTGCTCGCCGGTGCCCTTCCTGTGTTTCCCGGC
CGTCCCCTGGTCGCAGCCGGCGCCAGGTGCTGCGACGGCGGCATTCGCGGGAGGGTCTCC
TGCTCCTCCCACCGTCGCTCGGACCATCCCTCCTGCGCGGCTGAGGTGAGCACGCGCTGG
TTGCTGGTCTCTCCTCATCCAAATGGCTTCCAAAGCTGTAGCGTTCGCTTCAGTTTAATC
GTGTGGTTGTCTGGTTTGGTGCAGGAGGGAGGAGTGGTGGAGCTGCTCAAGGGCGCGGTC
GCGGCGCTCGCCGTCATCGCCCAGATTTCCGTGTCGCTCCCGGCGGACGCGATCCTCTAC
TCGCCGGACACGAACGTGCCGAGGACGGGGGAGCTGGCGCTGAGGAGGGCCATCCCCGCG
AACCCAAACATGAAGACCATACAGGAATCGCTGGAGGACATTTCGTATTTGCTGAGGATA
CCGCAGAGGAAGCCGTATGGCTCCATGGAAGGAGACGTAAAAAAGGCCATGAAGATAGCA
ATGGACAACAAGGATGCGATCTTGGCAAGTATACCTGTAGAACTCAAGGAAAAGGGCTCG
AAGTTATATACCTCCTTGCTTGAAGAGAAGGGTGGTTTGCAAACTCTCTTGAAATATATA
AAGGAAAATGATCCTGACAGACTTTCGGTTGCACTTGCTTCTTCTCTTGATACTGTTGCT
GAATTGGAGCTGTTACAGGCTCCAGGTTTATCCTTCCTCTTACCACAACAATATTTGGAA
TATCCAAGGCTAGCAGGAAGAGGAGTTGTTGAATTCTCAGTGGAGAAAGGTGATGGTTCA
ACATTCTTTCCAACTGCTGGTGGTGAACCAAAAAGTGTTGCTACAATTCAGGTAGTGATT
GATGGATATTCTGCCCCACTGACTGCTGGAAACTTTGCGAAATTGGTGTTGGATGGGGCA
TATGATGGGATAAAACTGAAATGTGCAAGTCAGGCAATTATTGCAGACAACGAGAATGGA
AAGAAAGGTTACACTGTTCCATTAGAGGTCATGCCTGCTGGGCAGTTTGAACCGTTATAC
AGAACTCCGCTAAGTATTCAGGATGGAGAATTGCCAGTCCTTCCGATGTCTGTATATGGT
GCCGTTGCTATGGCCCATAGTGTGGATTCTGATGAATACTCGTCACCAAGCCAATTCTTC
TTCTATCTGTATGACAAGAGAAATTCTGGTTTAGGAGGAATATCTTTTGATGAAGGGCAA
TTCTCAGTATTCGGGTATACCACAGATGGAAGAGAAGTTCTGTCGCAGATTAAAACTGGA
GATATAATTCGTTCTGCCAAGCTTGTACAAGGTAGAGAGCGCCTTGTACTGCCTCCAGAA
GCGCCGGCAGAGAGCTGA

Protein

466 aa

>Os07t0565600-01 Similar to predicted protein.
MASRAAAAMVLAGALPVFPGRPLVAAGARCCDGGIRGRVSCSSHRRSDHPSCAAEVSTRW
LLVSPHPNGFQSCSVRFSLIVWLSGLVQEGGVVELLKGAVAALAVIAQISVSLPADAILY
SPDTNVPRTGELALRRAIPANPNMKTIQESLEDISYLLRIPQRKPYGSMEGDVKKAMKIA
MDNKDAILASIPVELKEKGSKLYTSLLEEKGGLQTLLKYIKENDPDRLSVALASSLDTVA
ELELLQAPGLSFLLPQQYLEYPRLAGRGVVEFSVEKGDGSTFFPTAGGEPKSVATIQVVI
DGYSAPLTAGNFAKLVLDGAYDGIKLKCASQAIIADNENGKKGYTVPLEVMPAGQFEPLY
RTPLSIQDGELPVLPMSVYGAVAMAHSVDSDEYSSPSQFFFYLYDKRNSGLGGISFDEGQ
FSVFGYTTDGREVLSQIKTGDIIRSAKLVQGRERLVLPPEAPAES*

5'UTR

chr07:22688900..22689082 (+ strand) : 183 bp

CDS

chr07:22689083..22689526 (+ strand) : 444 bp

chr07:22689615..22689704 (+ strand) : 90 bp

chr07:22689850..22689945 (+ strand) : 96 bp

chr07:22690064..22690171 (+ strand) : 108 bp

chr07:22690274..22690323 (+ strand) : 50 bp

chr07:22691535..22691637 (+ strand) : 103 bp

chr07:22691823..22691876 (+ strand) : 54 bp

chr07:22692121..22692276 (+ strand) : 156 bp

chr07:22692494..22692616 (+ strand) : 123 bp

chr07:22692842..22692891 (+ strand) : 50 bp

chr07:22692993..22693116 (+ strand) : 124 bp

3'UTR

chr07:22693117..22693251 (+ strand) : 135 bp

FASTA

>Os07t0565600-01 class=Sequence position=chr07:22688900..22693251 (+ strand)
AGCTCACTGG CTGGGGATAG ACGAGACGGC GACCACGACG ATGACGATGA CGACGACGAC GGCGACGGCA GCAACGGCAT
CCCCACCACC ACCCCCATCT CCGGTTCCTC CCCTCCCCGC GTCTCAACCC ACCGGAAATC CATTCAAAAG CACCCGCGCT
CCCGCACCAA TCCACCGCAC GCCATGGCGT CGCGAGCGGC GGCCGCGATG GTGCTCGCCG GTGCCCTTCC TGTGTTTCCC
GGCCGTCCCC TGGTCGCAGC CGGCGCCAGG TGCTGCGACG GCGGCATTCG CGGGAGGGTC TCCTGCTCCT CCCACCGTCG
CTCGGACCAT CCCTCCTGCG CGGCTGAGGT GAGCACGCGC TGGTTGCTGG TCTCTCCTCA TCCAAATGGC TTCCAAAGCT
GTAGCGTTCG CTTCAGTTTA ATCGTGTGGT TGTCTGGTTT GGTGCAGGAG GGAGGAGTGG TGGAGCTGCT CAAGGGCGCG
GTCGCGGCGC TCGCCGTCAT CGCCCAGATT TCCGTGTCGC TCCCGGCGGA CGCGATCCTC TACTCGCCGG ACACGAACGT
GCCGAGGACG GGGGAGCTGG CGCTGAGGAG GGCCATCCCC GCGAACCCAA ACATGAAGAC CATACAGGTA AACTGCATCA
GAATCGGCGG CGATGCATAT CGCTTAGTAC GGTTGGCTGG GCGTTGTTCT TAGATTGTGC GAGCCCATTT GCCAGGAATC
GCTGGAGGAC ATTTCGTATT TGCTGAGGAT ACCGCAGAGG AAGCCGTATG GCTCCATGGA AGGAGACGTA AAAAAGGCCA
TGAAGGTAAT AAGTTGACTC TGTGTCTTCT TCATAAGCAT TTTTCTAGCA ACAATGTTTT GCTTCTTCTA TGCATTGTGA
ACTTCTTATT GAACTTGCTG AGCTGTTGTC CTGAATGCTG ATATATAGAA CAAATGCGCT CTGGATGCAG ATAGCAATGG
ACAACAAGGA TGCGATCTTG GCAAGTATAC CTGTAGAACT CAAGGAAAAG GGCTCGAAGT TATATACCTC CTTGCTTGAA
GAGAAGGTCA GTAGGTTCTA GGATGTGCTC ATGGTGAATT GCAGTTTATG AAACAGATCA AATTCTGGTT TTCACTTGTA
CTTATTTATA AATTATACCT GAGCTACTTT GGAATCAACT GCAGGGTGGT TTGCAAACTC TCTTGAAATA TATAAAGGAA
AATGATCCTG ACAGACTTTC GGTTGCACTT GCTTCTTCTC TTGATACTGT TGCTGAATTG GAGCTGTTAC AGGTAACTGT
ACTAAACTGA ATAGAAGTTT CATTATGTTT AAAGGAGGAT GATTATACTC CGGCGATGAT CGGATTACTT AAAGGGGGAA
ATTTCTTTCA ACAGGCTCCA GGTTTATCCT TCCTCTTACC ACAACAATAT TTGGAATATC CAAGGTAACT TTTGTTGATC
TCTCCAAAGC TTAAAATCTA AATGTTTCTT TGTCTCTAGA ATTATTGTGA GGGAAGGGCA GAGATAGGTC CGAAGATTGA
AGGTGACATT TGATTATACT GAGTTACTGA CATGCATGGT TCTATGTCCT GCAAACAAGT ATAAGCTCTA TGTCAGTATA
AGTTTTAAGA TAACCAGGTC TCTGCCCCCA AGTTCTTGAT GGTAATAATC AAAGCTGCCG CTATTAGTAG GTTTTCAAAA
TGAATTCAAT AGAAAACTTA CCAGTTTTTC CATTGTTGCA AATTAATTGG TTTTGACAAA CTTGCCATTT TATCATATTT
GCAAACTCAC TATTTATTGC TGGTGTCACC CTTCATATAT TTCATGGAGT AGAAACTGTC GAATAAAAAG TACTTTCTAG
TTAATTCCAA GTGGGAACTT ATTTTTATTT ATAACATATA TCATCACATA GTATTATAAA ATCATTAAGG CCAGATTGGT
ACAGGGTGGC AAGAAAACCT CACAAGCATT TTTCTTTTCG AACTCTTGAG GAATGGTGAA TTTTTCTTGG GTTCTGATTG
GCTGATCGCT TCAGCAGCAA TGTCGGTAAA TTTGAGCGCA TGTTTTTAGT TTACTTAGTC GTCCTTTAGG TCCCCTGTTT
TTCTTCTGTT TTGGGTCTTT GGGGTCGGTG AAGTATGGGC CCAGGTTGTT GTCCAAGTTG TCCATTTTAG GTGCGCACTT
TTGCGCCAGA GCGAGTCGTG TCCTTGTCGC GCCCGGCACA TTCTGATCAT GTGGGATGGC ACACGACACG GTGGAACGTG
TCATGTGCAT GAAGGCCTCA ATGGAAACTA CTTTGGGCCT CCTGTAATCC Gtataaacaa cagtggagaa aactgagaaa
agctacagtg agattgcgca gcgccaaatt cattcgcgtc tctgttcttt gttcttgtga gtgttcCTTC AATCCCAGGG
GGATCGCTGA CAAGCAATAC ACTCAGTATG TGTAGCTGAT TAGCAGATTA TGTAAGGTGG TGTTTGGATG GGAGGGGGAC
TAAAATAAGT CCCTCCCATC CCAAACAGGC CCTAAGTGTA ATGGTGCTTT GAACATTCCA TCCCTGTGGC ACTTATATTA
AGCATGCAAT CATTCCTCCA GTCTGTAACG AAATGTTCAT TTGTACATTT AATTTAAACA GCTCGCTTTT AATAGGCTAG
CAGGAAGAGG AGTTGTTGAA TTCTCAGTGG AGAAAGGTGA TGGTTCAACA TTCTTTCCAA CTGCTGGTGG TGAACCAAAA
AGTGTTGCTA CAATTCAGGT GGCTTTGAAT GGCTGTGTAA TTGTCTGGTA TCATAAACTG CAGTCTTTTG ACATTGAGAA
ATAAGAACCT TATCCTTGGT TGTTATCTTT TGTCATACCA TGGTGTGCAA GAGTATGGTT CTGTATACAG TTGCAGTTAT
AAAATTCCAC GTGTCAGCTA TTGATTTCTT TACTAATTTC CAGGTAGTGA TTGATGGATA TTCTGCCCCA CTGACTGCTG
GAAACTTTGC GAAATTGGTA AGGTAGCTTA ACTCCAACCT CATCTCACTA TTGATTATTT CCTGCCAATA GCTCTGCCTT
CTGACATATA TGATAAAGAT CATCGAAATG ATTGTGTTCA TCGACATAAC ATCTTCGAGA ACATCAATTT AAGATTTCAT
GTTTCTGCGA TGTGCTAAAA AAATTTCCTT TACTAGCTCT TGATTTTCTT TTCAGTAGTT AGGTTACATC ATCTGATCCA
ATGAAATGAA CTTTTCTTCA GGTGTTGGAT GGGGCATATG ATGGGATAAA ACTGAAATGT GCAAGTCAGG CAATTATTGC
AGACAACGAG AATGGAAAGA AAGGTTACAC TGTTCCATTA GAGGTCATGC CTGCTGGGCA GTTTGAACCG TTATACAGAA
CTCCGCTAAG TATTCAGGTC AGTATTCCAC ACTGTTAGGT CTGTTCTGAA GGGGTATTTG GATCTAAATC ATCAATCAAA
ATCCTTACGA TTTAGTTCAA ACTGGAAGTG TATGTAAAAA GGATATTAAA GAAAGCCCAC TCATCTGGAC TACCCTGTAA
ATGCCAGTGA AATCTGAGAG TTACCGTCTT TCGTAAGTCA TAACCCAGTT CCTTTGTTAC TTGATCCAAT ACAGGATGGA
GAATTGCCAG TCCTTCCGAT GTCTGTATAT GGTGCCGTTG CTATGGCCCA TAGTGTGGAT TCTGATGAAT ACTCGTCACC
AAGCCAATTC TTCTTCTATC TGTATGACAA GAGAAATGTG AGTAAATGGA TATATCTTTA GAACTAGACA TATTCGCTAG
CACAGTATTT TAAATTCAGA TTGCATAAGT GCATGTACCT CAACAGTGCA CCCGTCTACC TCTTGTGTTG TGAACCATAT
TTCTGAATGC TTCTGCTTTT CTAGACCCAT AGCGTGCCCT ATGTATAAGA ACTAATTGCG TAAATATTTT AATTTGTGAT
TATTTTCCTT TATCTTGTGC AGTCTGGTTT AGGAGGAATA TCTTTTGATG AAGGGCAATT CTCAGTATTC GGGTAAGTAG
TGATTGCCAT TACAGAACTG TGACCACTAG ACAGCAAACT TGGTTTATTT TGTGGATTAA CAACAGAGAA CTGTGTCGAT
CAAACATCTG CAGGTATACC ACAGATGGAA GAGAAGTTCT GTCGCAGATT AAAACTGGAG ATATAATTCG TTCTGCCAAG
CTTGTACAAG GTAGAGAGCG CCTTGTACTG CCTCCAGAAG CGCCGGCAGA GAGCTGATAC AACGGCAAGC TTCGCAAACT
GGAAACATTC TTTCATTGGT CAGGAGACTT AGCATATTTT ATACCATAAA TCATGTAAAC CTGACTGAGC AGTTCATCAA
ATTTATATAT AGAATCACTG CAAATGTTCA TC

Locus: Os07g0565600

Loading...

Locus: Os07g0565600

Loading...