Os07t0565600-02

Locus

Os07g0565600

Description

Similar to Peptidyl-prolyl cis-trans isomerase TLP38, chloroplast precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Thylakoid lumen PPIase of 38 kDa) (p38).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP37

CGSNL Gene Name

CYCLOPHILIN 37

Oryzabase Gene Symbol Synonym(s)

OsCYP37, OsCYP37a, OsCYP37b

Oryzabase Gene Name Synonym(s)

cyclophilin 37

Transcript Evidence

AK071983 (DDBJ, Best hit)

Protein Evidence

XP_002885091.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

J013089O03 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0565600-02)

RiceXPro (AK071983)

Others

Oryzabase (10068)

KEGG (Os07t0565600-02 (EC:5.2.1.8))

Transcript

1536 bp

>Os07t0565600-02 Similar to Peptidyl-prolyl cis-trans isomerase TLP38, chloroplast precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Thylakoid lumen PPIase of 38 kDa) (p38).
CTCCCCGCGTCTCAACCCACCGGAAATCCATTCAAAAGCACCCGCGCTCCCGCACCAATC
CACCGCACGCCATGGCGTCGCGAGCGGCGGCCGCGATGGTGCTCGCCGGTGCCCTTCCTG
TGTTTCCCGGCCGTCCCCTGGTCGCAGCCGGCGCCAGGTGCTGCGACGGCGGCATTCGCG
GGAGGGTCTCCTGCTCCTCCCACCGTCGCTCGGACCATCCCTCCTGCGCGGCTGAGGAGG
GAGGAGTGGTGGAGCTGCTCAAGGGCGCGGTCGCGGCGCTCGCCGTCATCGCCCAGATTT
CCGTGTCGCTCCCGGCGGACGCGATCCTCTACTCGCCGGACACGAACGTGCCGAGGACGG
GGGAGCTGGCGCTGAGGAGGGCCATCCCCGCGAACCCAAACATGAAGACCATACAGGAAT
CGCTGGAGGACATTTCGTATTTGCTGAGGATACCGCAGAGGAAGCCGTATGGCTCCATGG
AAGGAGACGTAAAAAAGGCCATGAAGATAGCAATGGACAACAAGGATGCGATCTTGGCAA
GTATACCTGTAGAACTCAAGGAAAAGGGCTCGAAGTTATATACCTCCTTGCTTGAAGAGA
AGGGTGGTTTGCAAACTCTCTTGAAATATATAAAGGAAAATGATCCTGACAGACTTTCGG
TTGCACTTGCTTCTTCTCTTGATACTGTTGCTGAATTGGAGCTGTTACAGGCTCCAGGTT
TATCCTTCCTCTTACCACAACAATATTTGGAATATCCAAGGCTAGCAGGAAGAGGAGTTG
TTGAATTCTCAGTGGAGAAAGGTGATGGTTCAACATTCTTTCCAACTGCTGGTGGTGAAC
CAAAAAGTGTTGCTACAATTCAGGTAGTGATTGATGGATATTCTGCCCCACTGACTGCTG
GAAACTTTGCGAAATTGGTGTTGGATGGGGCATATGATGGGATAAAACTGAAATGTGCAA
GTCAGGCAATTATTGCAGACAACGAGAATGGAAAGAAAGGTTACACTGTTCCATTAGAGG
TCATGCCTGCTGGGCAGTTTGAACCGTTATACAGAACTCCGCTAAGTATTCAGGATGGAG
AATTGCCAGTCCTTCCGATGTCTGTATATGGTGCCGTTGCTATGGCCCATAGTGTGGATT
CTGATGAATACTCGTCACCAAGCCAATTCTTCTTCTATCTGTATGACAAGAGAAATTCTG
GTTTAGGAGGAATATCTTTTGATGAAGGGCAATTCTCAGTATTCGGGTATACCACAGATG
GAAGAGAAGTTCTGTCGCAGATTAAAACTGGAGATATAATTCGTTCTGCCAAGCTTGTAC
AAGGTAGAGAGCGCCTTGTACTGCCTCCAGAAGCGCCGGCAGAGAGCTGATACAACGGCA
AGCTTCGCAAACTGGAAACATTCTTTCATTGGTCAGGAGACTTAGCATATTTTATACCAT
AAATCATGTAAACCTGACTGAGCAGTTCATCAAATTTATATATAGAATCACTGCAAATGT
TCATCAAATTTATATATAGAATCACTGCAAATTTGC

CDS

1299 bp

>Os07t0565600-02 Similar to Peptidyl-prolyl cis-trans isomerase TLP38, chloroplast precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Thylakoid lumen PPIase of 38 kDa) (p38).
ATGGCGTCGCGAGCGGCGGCCGCGATGGTGCTCGCCGGTGCCCTTCCTGTGTTTCCCGGC
CGTCCCCTGGTCGCAGCCGGCGCCAGGTGCTGCGACGGCGGCATTCGCGGGAGGGTCTCC
TGCTCCTCCCACCGTCGCTCGGACCATCCCTCCTGCGCGGCTGAGGAGGGAGGAGTGGTG
GAGCTGCTCAAGGGCGCGGTCGCGGCGCTCGCCGTCATCGCCCAGATTTCCGTGTCGCTC
CCGGCGGACGCGATCCTCTACTCGCCGGACACGAACGTGCCGAGGACGGGGGAGCTGGCG
CTGAGGAGGGCCATCCCCGCGAACCCAAACATGAAGACCATACAGGAATCGCTGGAGGAC
ATTTCGTATTTGCTGAGGATACCGCAGAGGAAGCCGTATGGCTCCATGGAAGGAGACGTA
AAAAAGGCCATGAAGATAGCAATGGACAACAAGGATGCGATCTTGGCAAGTATACCTGTA
GAACTCAAGGAAAAGGGCTCGAAGTTATATACCTCCTTGCTTGAAGAGAAGGGTGGTTTG
CAAACTCTCTTGAAATATATAAAGGAAAATGATCCTGACAGACTTTCGGTTGCACTTGCT
TCTTCTCTTGATACTGTTGCTGAATTGGAGCTGTTACAGGCTCCAGGTTTATCCTTCCTC
TTACCACAACAATATTTGGAATATCCAAGGCTAGCAGGAAGAGGAGTTGTTGAATTCTCA
GTGGAGAAAGGTGATGGTTCAACATTCTTTCCAACTGCTGGTGGTGAACCAAAAAGTGTT
GCTACAATTCAGGTAGTGATTGATGGATATTCTGCCCCACTGACTGCTGGAAACTTTGCG
AAATTGGTGTTGGATGGGGCATATGATGGGATAAAACTGAAATGTGCAAGTCAGGCAATT
ATTGCAGACAACGAGAATGGAAAGAAAGGTTACACTGTTCCATTAGAGGTCATGCCTGCT
GGGCAGTTTGAACCGTTATACAGAACTCCGCTAAGTATTCAGGATGGAGAATTGCCAGTC
CTTCCGATGTCTGTATATGGTGCCGTTGCTATGGCCCATAGTGTGGATTCTGATGAATAC
TCGTCACCAAGCCAATTCTTCTTCTATCTGTATGACAAGAGAAATTCTGGTTTAGGAGGA
ATATCTTTTGATGAAGGGCAATTCTCAGTATTCGGGTATACCACAGATGGAAGAGAAGTT
CTGTCGCAGATTAAAACTGGAGATATAATTCGTTCTGCCAAGCTTGTACAAGGTAGAGAG
CGCCTTGTACTGCCTCCAGAAGCGCCGGCAGAGAGCTGA

Protein

433 aa

>Os07t0565600-02 Similar to Peptidyl-prolyl cis-trans isomerase TLP38, chloroplast precursor (EC 5.2.1.8) (PPIase) (Rotamase) (Thylakoid lumen PPIase of 38 kDa) (p38).
MASRAAAAMVLAGALPVFPGRPLVAAGARCCDGGIRGRVSCSSHRRSDHPSCAAEEGGVV
ELLKGAVAALAVIAQISVSLPADAILYSPDTNVPRTGELALRRAIPANPNMKTIQESLED
ISYLLRIPQRKPYGSMEGDVKKAMKIAMDNKDAILASIPVELKEKGSKLYTSLLEEKGGL
QTLLKYIKENDPDRLSVALASSLDTVAELELLQAPGLSFLLPQQYLEYPRLAGRGVVEFS
VEKGDGSTFFPTAGGEPKSVATIQVVIDGYSAPLTAGNFAKLVLDGAYDGIKLKCASQAI
IADNENGKKGYTVPLEVMPAGQFEPLYRTPLSIQDGELPVLPMSVYGAVAMAHSVDSDEY
SSPSQFFFYLYDKRNSGLGGISFDEGQFSVFGYTTDGREVLSQIKTGDIIRSAKLVQGRE
RLVLPPEAPAES*

5'UTR

chr07:22689012..22689082 (+ strand) : 71 bp

CDS

chr07:22689083..22689247 (+ strand) : 165 bp

chr07:22689347..22689526 (+ strand) : 180 bp

chr07:22689615..22689704 (+ strand) : 90 bp

chr07:22689850..22689945 (+ strand) : 96 bp

chr07:22690064..22690171 (+ strand) : 108 bp

chr07:22690274..22690323 (+ strand) : 50 bp

chr07:22691535..22691637 (+ strand) : 103 bp

chr07:22691823..22691876 (+ strand) : 54 bp

chr07:22692121..22692276 (+ strand) : 156 bp

chr07:22692494..22692616 (+ strand) : 123 bp

chr07:22692842..22692891 (+ strand) : 50 bp

chr07:22692993..22693116 (+ strand) : 124 bp

3'UTR

chr07:22693117..22693282 (+ strand) : 166 bp

FASTA

>Os07t0565600-02 class=Sequence position=chr07:22689012..22693282 (+ strand)
CTCCCCGCGT CTCAACCCAC CGGAAATCCA TTCAAAAGCA CCCGCGCTCC CGCACCAATC CACCGCACGC CATGGCGTCG
CGAGCGGCGG CCGCGATGGT GCTCGCCGGT GCCCTTCCTG TGTTTCCCGG CCGTCCCCTG GTCGCAGCCG GCGCCAGGTG
CTGCGACGGC GGCATTCGCG GGAGGGTCTC CTGCTCCTCC CACCGTCGCT CGGACCATCC CTCCTGCGCG GCTGAGGTGA
GCACGCGCTG GTTGCTGGTC TCTCCTCATC CAAATGGCTT CCAAAGCTGT AGCGTTCGCT TCAGTTTAAT CGTGTGGTTG
TCTGGTTTGG TGCAGGAGGG AGGAGTGGTG GAGCTGCTCA AGGGCGCGGT CGCGGCGCTC GCCGTCATCG CCCAGATTTC
CGTGTCGCTC CCGGCGGACG CGATCCTCTA CTCGCCGGAC ACGAACGTGC CGAGGACGGG GGAGCTGGCG CTGAGGAGGG
CCATCCCCGC GAACCCAAAC ATGAAGACCA TACAGGTAAA CTGCATCAGA ATCGGCGGCG ATGCATATCG CTTAGTACGG
TTGGCTGGGC GTTGTTCTTA GATTGTGCGA GCCCATTTGC CAGGAATCGC TGGAGGACAT TTCGTATTTG CTGAGGATAC
CGCAGAGGAA GCCGTATGGC TCCATGGAAG GAGACGTAAA AAAGGCCATG AAGGTAATAA GTTGACTCTG TGTCTTCTTC
ATAAGCATTT TTCTAGCAAC AATGTTTTGC TTCTTCTATG CATTGTGAAC TTCTTATTGA ACTTGCTGAG CTGTTGTCCT
GAATGCTGAT ATATAGAACA AATGCGCTCT GGATGCAGAT AGCAATGGAC AACAAGGATG CGATCTTGGC AAGTATACCT
GTAGAACTCA AGGAAAAGGG CTCGAAGTTA TATACCTCCT TGCTTGAAGA GAAGGTCAGT AGGTTCTAGG ATGTGCTCAT
GGTGAATTGC AGTTTATGAA ACAGATCAAA TTCTGGTTTT CACTTGTACT TATTTATAAA TTATACCTGA GCTACTTTGG
AATCAACTGC AGGGTGGTTT GCAAACTCTC TTGAAATATA TAAAGGAAAA TGATCCTGAC AGACTTTCGG TTGCACTTGC
TTCTTCTCTT GATACTGTTG CTGAATTGGA GCTGTTACAG GTAACTGTAC TAAACTGAAT AGAAGTTTCA TTATGTTTAA
AGGAGGATGA TTATACTCCG GCGATGATCG GATTACTTAA AGGGGGAAAT TTCTTTCAAC AGGCTCCAGG TTTATCCTTC
CTCTTACCAC AACAATATTT GGAATATCCA AGGTAACTTT TGTTGATCTC TCCAAAGCTT AAAATCTAAA TGTTTCTTTG
TCTCTAGAAT TATTGTGAGG GAAGGGCAGA GATAGGTCCG AAGATTGAAG GTGACATTTG ATTATACTGA GTTACTGACA
TGCATGGTTC TATGTCCTGC AAACAAGTAT AAGCTCTATG TCAGTATAAG TTTTAAGATA ACCAGGTCTC TGCCCCCAAG
TTCTTGATGG TAATAATCAA AGCTGCCGCT ATTAGTAGGT TTTCAAAATG AATTCAATAG AAAACTTACC AGTTTTTCCA
TTGTTGCAAA TTAATTGGTT TTGACAAACT TGCCATTTTA TCATATTTGC AAACTCACTA TTTATTGCTG GTGTCACCCT
TCATATATTT CATGGAGTAG AAACTGTCGA ATAAAAAGTA CTTTCTAGTT AATTCCAAGT GGGAACTTAT TTTTATTTAT
AACATATATC ATCACATAGT ATTATAAAAT CATTAAGGCC AGATTGGTAC AGGGTGGCAA GAAAACCTCA CAAGCATTTT
TCTTTTCGAA CTCTTGAGGA ATGGTGAATT TTTCTTGGGT TCTGATTGGC TGATCGCTTC AGCAGCAATG TCGGTAAATT
TGAGCGCATG TTTTTAGTTT ACTTAGTCGT CCTTTAGGTC CCCTGTTTTT CTTCTGTTTT GGGTCTTTGG GGTCGGTGAA
GTATGGGCCC AGGTTGTTGT CCAAGTTGTC CATTTTAGGT GCGCACTTTT GCGCCAGAGC GAGTCGTGTC CTTGTCGCGC
CCGGCACATT CTGATCATGT GGGATGGCAC ACGACACGGT GGAACGTGTC ATGTGCATGA AGGCCTCAAT GGAAACTACT
TTGGGCCTCC TGTAATCCGt ataaacaaca gtggagaaaa ctgagaaaag ctacagtgag attgcgcagc gccaaattca
ttcgcgtctc tgttctttgt tcttgtgagt gttcCTTCAA TCCCAGGGGG ATCGCTGACA AGCAATACAC TCAGTATGTG
TAGCTGATTA GCAGATTATG TAAGGTGGTG TTTGGATGGG AGGGGGACTA AAATAAGTCC CTCCCATCCC AAACAGGCCC
TAAGTGTAAT GGTGCTTTGA ACATTCCATC CCTGTGGCAC TTATATTAAG CATGCAATCA TTCCTCCAGT CTGTAACGAA
ATGTTCATTT GTACATTTAA TTTAAACAGC TCGCTTTTAA TAGGCTAGCA GGAAGAGGAG TTGTTGAATT CTCAGTGGAG
AAAGGTGATG GTTCAACATT CTTTCCAACT GCTGGTGGTG AACCAAAAAG TGTTGCTACA ATTCAGGTGG CTTTGAATGG
CTGTGTAATT GTCTGGTATC ATAAACTGCA GTCTTTTGAC ATTGAGAAAT AAGAACCTTA TCCTTGGTTG TTATCTTTTG
TCATACCATG GTGTGCAAGA GTATGGTTCT GTATACAGTT GCAGTTATAA AATTCCACGT GTCAGCTATT GATTTCTTTA
CTAATTTCCA GGTAGTGATT GATGGATATT CTGCCCCACT GACTGCTGGA AACTTTGCGA AATTGGTAAG GTAGCTTAAC
TCCAACCTCA TCTCACTATT GATTATTTCC TGCCAATAGC TCTGCCTTCT GACATATATG ATAAAGATCA TCGAAATGAT
TGTGTTCATC GACATAACAT CTTCGAGAAC ATCAATTTAA GATTTCATGT TTCTGCGATG TGCTAAAAAA ATTTCCTTTA
CTAGCTCTTG ATTTTCTTTT CAGTAGTTAG GTTACATCAT CTGATCCAAT GAAATGAACT TTTCTTCAGG TGTTGGATGG
GGCATATGAT GGGATAAAAC TGAAATGTGC AAGTCAGGCA ATTATTGCAG ACAACGAGAA TGGAAAGAAA GGTTACACTG
TTCCATTAGA GGTCATGCCT GCTGGGCAGT TTGAACCGTT ATACAGAACT CCGCTAAGTA TTCAGGTCAG TATTCCACAC
TGTTAGGTCT GTTCTGAAGG GGTATTTGGA TCTAAATCAT CAATCAAAAT CCTTACGATT TAGTTCAAAC TGGAAGTGTA
TGTAAAAAGG ATATTAAAGA AAGCCCACTC ATCTGGACTA CCCTGTAAAT GCCAGTGAAA TCTGAGAGTT ACCGTCTTTC
GTAAGTCATA ACCCAGTTCC TTTGTTACTT GATCCAATAC AGGATGGAGA ATTGCCAGTC CTTCCGATGT CTGTATATGG
TGCCGTTGCT ATGGCCCATA GTGTGGATTC TGATGAATAC TCGTCACCAA GCCAATTCTT CTTCTATCTG TATGACAAGA
GAAATGTGAG TAAATGGATA TATCTTTAGA ACTAGACATA TTCGCTAGCA CAGTATTTTA AATTCAGATT GCATAAGTGC
ATGTACCTCA ACAGTGCACC CGTCTACCTC TTGTGTTGTG AACCATATTT CTGAATGCTT CTGCTTTTCT AGACCCATAG
CGTGCCCTAT GTATAAGAAC TAATTGCGTA AATATTTTAA TTTGTGATTA TTTTCCTTTA TCTTGTGCAG TCTGGTTTAG
GAGGAATATC TTTTGATGAA GGGCAATTCT CAGTATTCGG GTAAGTAGTG ATTGCCATTA CAGAACTGTG ACCACTAGAC
AGCAAACTTG GTTTATTTTG TGGATTAACA ACAGAGAACT GTGTCGATCA AACATCTGCA GGTATACCAC AGATGGAAGA
GAAGTTCTGT CGCAGATTAA AACTGGAGAT ATAATTCGTT CTGCCAAGCT TGTACAAGGT AGAGAGCGCC TTGTACTGCC
TCCAGAAGCG CCGGCAGAGA GCTGATACAA CGGCAAGCTT CGCAAACTGG AAACATTCTT TCATTGGTCA GGAGACTTAG
CATATTTTAT ACCATAAATC ATGTAAACCT GACTGAGCAG TTCATCAAAT TTATATATAG AATCACTGCA AATGTTCATC
AAATTTATAT ATAGAATCAC TGCAAATTTG C

Locus: Os07g0565600

Loading...

Locus: Os07g0565600

Loading...