Os07t0566500-01

Locus

Os07g0566500

Description

NAC transcription factor, Regulation of seed-storage protein content

RAP-DB Gene Symbol Synonym(s)

ONAC010

RAP-DB Gene Name Synonym(s)

NAC domain-containing protein 10

CGSNL Gene Symbol

NAC10

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 10

Oryzabase Gene Symbol Synonym(s)

ONAC010, ONAC10, OsSTA199

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 010, Grain Protein Content 2 homolog, GPC-B2 homolog, NAC domain-containing protein 10

Transcript Evidence

AK063406

Protein Evidence

Q8H4S4

Literature

PMID: 30945674

PMID: 22278768

PMID: 15029955

Note

Manual Curation

April 28, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain superfamily (IPR036093)

NAC domain (IPR003441)

Full-length cDNA

001-115-A08 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0566500-01)

RiceXPro (AK063406)

Others

Oryzabase (10355)

KEGG (Os07t0566500-01)

Transcript

1817 bp

>Os07t0566500-01 NAC transcription factor, Regulation of seed-storage protein content
AACTAGCTTAGCTAGACAGCGTGTGTTGGTGGTGGTGGTGGTGTGTGTGTGTGTGAGGAG
GGTGATCGATCGATCGAGCGATGGAGAGCCCGGACTCGTCGTCCGGCTCGGCGCCACCGC
GAGTACTACGGCGGCAACAGCAGCAGCCGGGCTCGGCGCCGgagctgccgccggggttcc
ggttccacccgacggacgaggagctggtggtgcactacctcaagaagaaggccgcctccg
ttccgctccccgtcaccatcatcgccgaggtcgatctctacaagttcgatccctgggatc
tccccgagaaggcgaacttcggggagcaggagtggtatttcttcagcccgagggaccgca
agtacccgaacggggcgcggccgaaccgggcggcgacgtcggggtactggaaggccaccg
gcaccgacaagcccatcatgtcgtcggggagcacccgcgagaaggtcggcgtgaagaagg
cgctcgtgttctaccggggcaagccacccaagggcgtcaagactaactggatcatgcacg
agtaccgtctcacGGACACGTCTAGCTCCGCCGCCGCCGTCGCTACGACCAGGCGGCCGC
CGCCGCCCATCACCGGCGGTAGCAAGGGCGCCGTCTCTCTCAGGCTGGATGACTGGGTGC
TGTGCCGCATATACAAGAAGACGAACAAGGCCGGTGCGGGGCAGAGGAGCATGGAGTGCG
AGGACTCCGTGGAGGACGCGGTGGCCGCGTACGCGCCGTCGTCGCAGCAGCATGCCACGG
CTGCTGCTGGCATGGCCGGTTCGGACGGCGCCGGAGGAGTTGCTGCAGCGCACGGCGGCG
ACTACAGTTCACTGCTCCATCACGACAGCCACGAGGACACCTTCCTCGTAAACGGCCTGC
TCACCGCGGAGGACGCCGCCGGCCTCTCGACCGGCGCCAGCTCTCTCAGCCAGCTCGCCG
CGGCGGCGAGGGCGGCGGCGACACCGTGCGACGCCACCAAGCAGCTTCTTGCTCCGTCTC
CAACCCCATTCAACTGGTTCGAGGCATTCCTTCCACGGGCCAAGGAGTTTCCTAGTGGGC
TAAGCAGGAGTAGCAGAGACATCGGCGACATGTCGCTGTCATCGACGGTGGACAGGAGCC
TGTCTGAGGCTGGCGCCGTGGCCATTGACACCGGCGACGCCGCCAATGGCGCAAACACTA
TGCCTGCATTTATCAATCCTCTCGGCGTGCAGGGTGCAACCTACCAACAACACCAAGCCA
TCATGGGTGCCTCGTTGCCATCGGAGTCAGCAGCAGCAGCAGCCGCCTGCAATTTCCAGC
ATCCGTTCCAACTCTCCAGGGTGAATTGGGATTCCTGAATAAAAGGTGCCGGCATTATGC
ATACACATATATGCACATGCATACATGCATGGCTTTTCAAGTAGTAGCACAACATTACTA
GTAATTAATCACACTAATGTGTGTGGCAGTCGCATTCAGTGAGCACTGATCGAGTAGTTG
CATGAACACAACACTAATGCATGCACTACATATATATGGCCGCATTGCTCCTAGGGCACG
TACCTGTACGAACTAGGTAAGTGACCTAACCAGCTAGATCATGTTCAGAATAAGGAGAAG
AAGCCGCATGCAAACACGTAGATCATATGGCTTTGCCTTCACATGCGTTTGCATCATATA
TATCGCATTCAGAAAGTAGTGCTGCAGCTAACACATAGATATGGTGTTAGCTTCATGCGT
TTGTACCATATATAGCGGATGCAGAAAGTAGCTAGTTGCACTGTTCATCATTATCCCATG
AGATATGAACTTTATAT

CDS

1278 bp

>Os07t0566500-01 NAC transcription factor, Regulation of seed-storage protein content
ATGGAGAGCCCGGACTCGTCGTCCGGCTCGGCGCCACCGCGAGTACTACGGCGGCAACAG
CAGCAGCCGGGCTCGGCGCCGgagctgccgccggggttccggttccacccgacggacgag
gagctggtggtgcactacctcaagaagaaggccgcctccgttccgctccccgtcaccatc
atcgccgaggtcgatctctacaagttcgatccctgggatctccccgagaaggcgaacttc
ggggagcaggagtggtatttcttcagcccgagggaccgcaagtacccgaacggggcgcgg
ccgaaccgggcggcgacgtcggggtactggaaggccaccggcaccgacaagcccatcatg
tcgtcggggagcacccgcgagaaggtcggcgtgaagaaggcgctcgtgttctaccggggc
aagccacccaagggcgtcaagactaactggatcatgcacgagtaccgtctcacGGACACG
TCTAGCTCCGCCGCCGCCGTCGCTACGACCAGGCGGCCGCCGCCGCCCATCACCGGCGGT
AGCAAGGGCGCCGTCTCTCTCAGGCTGGATGACTGGGTGCTGTGCCGCATATACAAGAAG
ACGAACAAGGCCGGTGCGGGGCAGAGGAGCATGGAGTGCGAGGACTCCGTGGAGGACGCG
GTGGCCGCGTACGCGCCGTCGTCGCAGCAGCATGCCACGGCTGCTGCTGGCATGGCCGGT
TCGGACGGCGCCGGAGGAGTTGCTGCAGCGCACGGCGGCGACTACAGTTCACTGCTCCAT
CACGACAGCCACGAGGACACCTTCCTCGTAAACGGCCTGCTCACCGCGGAGGACGCCGCC
GGCCTCTCGACCGGCGCCAGCTCTCTCAGCCAGCTCGCCGCGGCGGCGAGGGCGGCGGCG
ACACCGTGCGACGCCACCAAGCAGCTTCTTGCTCCGTCTCCAACCCCATTCAACTGGTTC
GAGGCATTCCTTCCACGGGCCAAGGAGTTTCCTAGTGGGCTAAGCAGGAGTAGCAGAGAC
ATCGGCGACATGTCGCTGTCATCGACGGTGGACAGGAGCCTGTCTGAGGCTGGCGCCGTG
GCCATTGACACCGGCGACGCCGCCAATGGCGCAAACACTATGCCTGCATTTATCAATCCT
CTCGGCGTGCAGGGTGCAACCTACCAACAACACCAAGCCATCATGGGTGCCTCGTTGCCA
TCGGAGTCAGCAGCAGCAGCAGCCGCCTGCAATTTCCAGCATCCGTTCCAACTCTCCAGG
GTGAATTGGGATTCCTGA

Protein

426 aa

>Os07t0566500-01 NAC transcription factor, Regulation of seed-storage protein content
MESPDSSSGSAPPRVLRRQQQQPGSAPELPPGFRFHPTDEELVVHYLKKKAASVPLPVTI
IAEVDLYKFDPWDLPEKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIM
SSGSTREKVGVKKALVFYRGKPPKGVKTNWIMHEYRLTDTSSSAAAVATTRRPPPPITGG
SKGAVSLRLDDWVLCRIYKKTNKAGAGQRSMECEDSVEDAVAAYAPSSQQHATAAAGMAG
SDGAGGVAAAHGGDYSSLLHHDSHEDTFLVNGLLTAEDAAGLSTGASSLSQLAAAARAAA
TPCDATKQLLAPSPTPFNWFEAFLPRAKEFPSGLSRSSRDIGDMSLSSTVDRSLSEAGAV
AIDTGDAANGANTMPAFINPLGVQGATYQQHQAIMGASLPSESAAAAAACNFQHPFQLSR
VNWDS*

5'UTR

chr07:22757473..22757552 (- strand) : 80 bp

CDS

chr07:22757247..22757472 (- strand) : 226 bp

chr07:22756674..22757011 (- strand) : 338 bp

chr07:22755876..22756589 (- strand) : 714 bp

3'UTR

chr07:22755417..22755875 (- strand) : 459 bp

FASTA

>Os07t0566500-01 class=Sequence position=chr07:22755417..22757552 (- strand)
AACTAGCTTA GCTAGACAGC GTGTGTTGGT GGTGGTGGTG GTGTGTGTGT GTGTGAGGAG GGTGATCGAT CGATCGAGCG
ATGGAGAGCC CGGACTCGTC GTCCGGCTCG GCGCCACCGC GAGTACTACG GCGGCAACAG CAGCAGCCGG GCTCGGCGCC
Ggagctgccg ccggggttcc ggttccaccc gacggacgag gagctggtgg tgcactacct caagaagaag gccgcctccg
ttccgctccc cgtcaccatc atcgccgagg tcgatctcta caagttcgat ccctgggatc tccccggtac gtaatttaat
cacttacacc cataccaatc ataaattaag aatttattat tacagcttat atatactatt atcatgcatg tatattatct
aaaaaaaatc agcccaaatc tccatatgca tgtgagcatg ctagcttgga tgtgtagtgc tcgatcgatc gatcgatcga
tcgatctggt gtcgtttact tgtttgtgcg atttatgcgt gcatgcatcg gtttgtatca gagaaggcga acttcgggga
gcaggagtgg tatttcttca gcccgaggga ccgcaagtac ccgaacgggg cgcggccgaa ccgggcggcg acgtcggggt
actggaaggc caccggcacc gacaagccca tcatgtcgtc ggggagcacc cgcgagaagg tcggcgtgaa gaaggcgctc
gtgttctacc ggggcaagcc acccaagggc gtcaagacta actggatcat gcacgagtac cgtctcacGG ACACGTCTAG
CTCCGCCGCC GCCGTCGCTA CGACCAGGCG GCCGCCGCCG CCCATCACCG GCGGTAGCAA GGGCGCCGTC TCTCTCAGGG
TACGTACGTA TATACGTTTG TGCGTGACAG TCTCGCTTGG AGTCTTGGAC TGATTGATCT GATCAAGTTG ATTAGTGTCT
CAGCTGGATG ACTGGGTGCT GTGCCGCATA TACAAGAAGA CGAACAAGGC CGGTGCGGGG CAGAGGAGCA TGGAGTGCGA
GGACTCCGTG GAGGACGCGG TGGCCGCGTA CGCGCCGTCG TCGCAGCAGC ATGCCACGGC TGCTGCTGGC ATGGCCGGTT
CGGACGGCGC CGGAGGAGTT GCTGCAGCGC ACGGCGGCGA CTACAGTTCA CTGCTCCATC ACGACAGCCA CGAGGACACC
TTCCTCGTAA ACGGCCTGCT CACCGCGGAG GACGCCGCCG GCCTCTCGAC CGGCGCCAGC TCTCTCAGCC AGCTCGCCGC
GGCGGCGAGG GCGGCGGCGA CACCGTGCGA CGCCACCAAG CAGCTTCTTG CTCCGTCTCC AACCCCATTC AACTGGTTCG
AGGCATTCCT TCCACGGGCC AAGGAGTTTC CTAGTGGGCT AAGCAGGAGT AGCAGAGACA TCGGCGACAT GTCGCTGTCA
TCGACGGTGG ACAGGAGCCT GTCTGAGGCT GGCGCCGTGG CCATTGACAC CGGCGACGCC GCCAATGGCG CAAACACTAT
GCCTGCATTT ATCAATCCTC TCGGCGTGCA GGGTGCAACC TACCAACAAC ACCAAGCCAT CATGGGTGCC TCGTTGCCAT
CGGAGTCAGC AGCAGCAGCA GCCGCCTGCA ATTTCCAGCA TCCGTTCCAA CTCTCCAGGG TGAATTGGGA TTCCTGAATA
AAAGGTGCCG GCATTATGCA TACACATATA TGCACATGCA TACATGCATG GCTTTTCAAG TAGTAGCACA ACATTACTAG
TAATTAATCA CACTAATGTG TGTGGCAGTC GCATTCAGTG AGCACTGATC GAGTAGTTGC ATGAACACAA CACTAATGCA
TGCACTACAT ATATATGGCC GCATTGCTCC TAGGGCACGT ACCTGTACGA ACTAGGTAAG TGACCTAACC AGCTAGATCA
TGTTCAGAAT AAGGAGAAGA AGCCGCATGC AAACACGTAG ATCATATGGC TTTGCCTTCA CATGCGTTTG CATCATATAT
ATCGCATTCA GAAAGTAGTG CTGCAGCTAA CACATAGATA TGGTGTTAGC TTCATGCGTT TGTACCATAT ATAGCGGATG
CAGAAAGTAG CTAGTTGCAC TGTTCATCAT TATCCCATGA GATATGAACT TTATAT

Locus: Os07g0566500

Loading...

Locus: Os07g0566500

Loading...