Os07t0580500-01

Locus

Os07g0580500

Description

Transcription factor, Brassinosteroid (BR)-regulated growth response, Feedback inhibition of BR biosynthesis

RAP-DB Gene Symbol Synonym(s)

BZR1, OsBZR1, Os BZR1

RAP-DB Gene Name Synonym(s)

BRASSINAZOLE RESISTANT 1, BRASSINAZOLE-RESISTANT1

CGSNL Gene Symbol

BZR1

CGSNL Gene Name

BRASSINAZOLE RESISTANT 1

Oryzabase Gene Symbol Synonym(s)

OsBZR1, Os BZR1

Oryzabase Gene Name Synonym(s)

BRASSINAZOLE-RESISTANT1

Transcript Evidence

AK106748

Protein Evidence

Q7XI96

Literature

PMID: 17699623

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

February 23, 2016

Functional domain (InterPro)

BES1/BZR1 plant transcription factor, N-terminal (IPR008540)

Full-length cDNA

002-115-C06 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0580500-01)

Others

Oryzabase (7160)

Transcript

1206 bp

>Os07t0580500-01 Transcription factor, Brassinosteroid (BR)-regulated growth response, Feedback inhibition of BR biosynthesis
AAAGGAGAGGTGGAGGAGAGGAGGGGAGGGGAGGGGAGGTGAGGGACGGAGCTGGTGGGT
ATGACGTCCGGGGCGGCGGCGGCGGGGAGGACGCCGACGTGGAAGGAGAGGGAGAACAAC
AAGAGGCGGGAGCGGCGGCGGCGTGCCATCGCCGCCAAGATCTTCACGGGGCTCCGGGCG
CTCGGGAACTACAACCTCCCCAAGCACTGCGACAACAACGAGGTGCTCAAGGCGCTCTGC
CGCGAGGCCGGCTGGGTTGTCGAGGACGACGGCACCACCTACCGCAAGGGATGTAAGCCG
CCGCCATCGTCGGCTGGGGGAGCGTCGGTGGGGATGAGCCCCTGCTCGTCAACGCAGCTG
CTGAGCGCGCCGTCGTCGTCGTTCCCGAGCCCGGTGCCGTCGTACCACGCGAGCCCGGCG
TCGTCGAGCTTCCCGAGCCCCAGCCGGATCGACAACCCGAGCGCCTCCTGCCTCCTCCCG
TTCCTCcgggggctccccaacctcccgccgctccgcgtctccagcagcgcgcccgtcacg
ccgccgctctcgtcgccgacggcgtcgcggccgcccaagatcaggaagccggactgggac
gtcgacccgttccggcaccccttcttcgcggtctccgcgccggcgagccccacccgcggc
cgccgcctcgagCACCCGGACACGATACCGGAGTGCGACGAGTCCGACGTCTCCACGGTG
GACTCCGGCCGGTGGATCAGCTTCCAGATGGCCACGACGGCGCCGACGTCGCCCACCTAC
AACCTCGTCAACCCGGGCGCCTCCACCTCCAACTCCATGGAGATAGAAGGGACGGCCGGC
CGAGGCGGCGCGGAGTTCGAGTTCGACAAGGGGAGGGTGACGCCATGGGAGGGCGAGAGG
ATCCACGAGGTCGCCGCCGAGGAGCTCGAGCTCACGCTCGGCGTCGGCGCGAAATGACGG
CCATTATTGCCGAGCAAAAAAGATGGTTCCTTTCGTGGACCTCGAGCACCAGCTGATCAT
GGTTGTTGTTAGATCAGTACTGGTCAATGTGTATGATCATGACTACGCATCGATGCTGCG
ATTTGGGCGATTTCATTCTAGCCTTAGGTTAATCTTGTTGTTCAATTCATTCTTCCTGGA
CTTGGGAAAAAGGAAGCAGGGAAAAATTGTTCATCACGGCTGATTTTATTCACGGCTTCA
CTGTTC

CDS

897 bp

>Os07t0580500-01 Transcription factor, Brassinosteroid (BR)-regulated growth response, Feedback inhibition of BR biosynthesis
ATGACGTCCGGGGCGGCGGCGGCGGGGAGGACGCCGACGTGGAAGGAGAGGGAGAACAAC
AAGAGGCGGGAGCGGCGGCGGCGTGCCATCGCCGCCAAGATCTTCACGGGGCTCCGGGCG
CTCGGGAACTACAACCTCCCCAAGCACTGCGACAACAACGAGGTGCTCAAGGCGCTCTGC
CGCGAGGCCGGCTGGGTTGTCGAGGACGACGGCACCACCTACCGCAAGGGATGTAAGCCG
CCGCCATCGTCGGCTGGGGGAGCGTCGGTGGGGATGAGCCCCTGCTCGTCAACGCAGCTG
CTGAGCGCGCCGTCGTCGTCGTTCCCGAGCCCGGTGCCGTCGTACCACGCGAGCCCGGCG
TCGTCGAGCTTCCCGAGCCCCAGCCGGATCGACAACCCGAGCGCCTCCTGCCTCCTCCCG
TTCCTCcgggggctccccaacctcccgccgctccgcgtctccagcagcgcgcccgtcacg
ccgccgctctcgtcgccgacggcgtcgcggccgcccaagatcaggaagccggactgggac
gtcgacccgttccggcaccccttcttcgcggtctccgcgccggcgagccccacccgcggc
cgccgcctcgagCACCCGGACACGATACCGGAGTGCGACGAGTCCGACGTCTCCACGGTG
GACTCCGGCCGGTGGATCAGCTTCCAGATGGCCACGACGGCGCCGACGTCGCCCACCTAC
AACCTCGTCAACCCGGGCGCCTCCACCTCCAACTCCATGGAGATAGAAGGGACGGCCGGC
CGAGGCGGCGCGGAGTTCGAGTTCGACAAGGGGAGGGTGACGCCATGGGAGGGCGAGAGG
ATCCACGAGGTCGCCGCCGAGGAGCTCGAGCTCACGCTCGGCGTCGGCGCGAAATGA

Protein

299 aa

>Os07t0580500-01 Transcription factor, Brassinosteroid (BR)-regulated growth response, Feedback inhibition of BR biosynthesis
MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALC
REAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPA
SSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWD
VDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTY
NLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK*

5'UTR

chr07:23485248..23485307 (- strand) : 60 bp

CDS

chr07:23485020..23485247 (- strand) : 228 bp

chr07:23484222..23484890 (- strand) : 669 bp

3'UTR

chr07:23483973..23484221 (- strand) : 249 bp

FASTA

>Os07t0580500-01 class=Sequence position=chr07:23483973..23485307 (- strand)
AAAGGAGAGG TGGAGGAGAG GAGGGGAGGG GAGGGGAGGT GAGGGACGGA GCTGGTGGGT ATGACGTCCG GGGCGGCGGC
GGCGGGGAGG ACGCCGACGT GGAAGGAGAG GGAGAACAAC AAGAGGCGGG AGCGGCGGCG GCGTGCCATC GCCGCCAAGA
TCTTCACGGG GCTCCGGGCG CTCGGGAACT ACAACCTCCC CAAGCACTGC GACAACAACG AGGTGCTCAA GGCGCTCTGC
CGCGAGGCCG GCTGGGTTGT CGAGGACGAC GGCACCACCT ACCGCAAGGT CAGTTCATGC TTGCCCGTCT CGATCTGGTC
TGGTCGTGTT GCTGTCCATT TCTTGGATCT TGGATGTGTA GATCTGGCCG GAGCTGAGCT GAGCTCGTGT TTCTTGTTTT
TTTTTTGGTC GTTGCAGGGA TGTAAGCCGC CGCCATCGTC GGCTGGGGGA GCGTCGGTGG GGATGAGCCC CTGCTCGTCA
ACGCAGCTGC TGAGCGCGCC GTCGTCGTCG TTCCCGAGCC CGGTGCCGTC GTACCACGCG AGCCCGGCGT CGTCGAGCTT
CCCGAGCCCC AGCCGGATCG ACAACCCGAG CGCCTCCTGC CTCCTCCCGT TCCTCcgggg gctccccaac ctcccgccgc
tccgcgtctc cagcagcgcg cccgtcacgc cgccgctctc gtcgccgacg gcgtcgcggc cgcccaagat caggaagccg
gactgggacg tcgacccgtt ccggcacccc ttcttcgcgg tctccgcgcc ggcgagcccc acccgcggcc gccgcctcga
gCACCCGGAC ACGATACCGG AGTGCGACGA GTCCGACGTC TCCACGGTGG ACTCCGGCCG GTGGATCAGC TTCCAGATGG
CCACGACGGC GCCGACGTCG CCCACCTACA ACCTCGTCAA CCCGGGCGCC TCCACCTCCA ACTCCATGGA GATAGAAGGG
ACGGCCGGCC GAGGCGGCGC GGAGTTCGAG TTCGACAAGG GGAGGGTGAC GCCATGGGAG GGCGAGAGGA TCCACGAGGT
CGCCGCCGAG GAGCTCGAGC TCACGCTCGG CGTCGGCGCG AAATGACGGC CATTATTGCC GAGCAAAAAA GATGGTTCCT
TTCGTGGACC TCGAGCACCA GCTGATCATG GTTGTTGTTA GATCAGTACT GGTCAATGTG TATGATCATG ACTACGCATC
GATGCTGCGA TTTGGGCGAT TTCATTCTAG CCTTAGGTTA ATCTTGTTGT TCAATTCATT CTTCCTGGAC TTGGGAAAAA
GGAAGCAGGG AAAAATTGTT CATCACGGCT GATTTTATTC ACGGCTTCAC TGTTC