Os07t0583700-01

Locus

Os07g0583700

Description

WRKY transcription factor, Regulation of stem elongation and seed development

RAP-DB Gene Symbol Synonym(s)

OsWRKY78, OsWRKY87

RAP-DB Gene Name Synonym(s)

WRKY transcription factor 78

CGSNL Gene Symbol

WRKY87

CGSNL Gene Name

WRKY GENE 87

Oryzabase Gene Symbol Synonym(s)

OsWRKY87, OsSUSIBA2-like

Oryzabase Gene Name Synonym(s)

Rice WRKY gene87, SUSABA2 Ortholog, Sugar signalling in barley 2-like

Transcript Evidence

AK070537

Protein Evidence

Q84ZS7

Literature

PMID: 21547461

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

September 2, 2021

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain superfamily (IPR036576)

WRKY domain (IPR003657)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023062H03 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0583700-01)

RiceXPro (AK070537)

Others

Oryzabase (6593)

KEGG (Os07t0583700-01)

Transcript

2327 bp

>Os07t0583700-01 WRKY transcription factor, Regulation of stem elongation and seed development
ACTCTCACGAGACAGCTTCCCACGCAGCGCAGCGCAACCGCAGCAATGGCCGATTCGCCA
AACCCTAGCTCCGGTGACCACCCCGCGGGCGTCGGCGGGTCGCCGGAGAAGCAGCCCCCG
GTGGATCGGCGCGTCGCGGCGCTCGCCGCGGGCGCGGCGGGCGCGGGGGCGAGGTACAAG
GCGATGTCCCCCGCGCGGCTGCCGATCTCGCGGGAGCCCTGCCTCACCATCCCCGCGGGC
TTCAGCCCCTCGGCTCTCCTCGAGTCCCCCGTCCTCCTCACCAACTTCAAGGTTGAACCC
TCTCCGACAACTGGTACTCTGAGCATGGCTGCAATTATGAACAAGAGTGCAAATCCAGAC
ATACTTCCTTCGCCTAGGGATAAAACATCTGGTAGCACCCATGAAGATGGTGGCTCTCGA
GATTTTGAATTCAAGCCTCATCTGAATTCATCCTCTCAATCGACGGCTTCTGCTATCAAT
GATCCCAAAAAGCATGAAACTTCTATGAAAAATGAAAGCCTGAATACTGCCCTGTCATCT
GACGATATGATGATCGACAATATACCTCTATGTTCTCGTGAGTCAACTCTCGCAGTCAAT
ATTTCAAGTGCCCCGAGCCAACTGGTTGGAATGGTTGGTTTAACTGACAGCTCACCTGCT
GAAGTTGGTACATCTGAGTTGCATCAGATGAATAGCTCTGGAAATGCTATGCAGGAGTCA
CAGCCTGAAAGTGTGGCTGAAAAGTCTGCAGAGGATGGTTATAACTGGCGCAAATATGGG
CAAAAGCATGTTAAGGGAAGTGAGAACCCGAGAAGCTATTACAAGTGCACACATCCTAAC
TGTGATGTAAAAAAGCTATTGGAGCGTTCGCTTGATGGTCAGATTACTGAAGTGGTTTAT
AAAGGGCGTCACAATCACCCTAAGCCCCAACCCAATAGGAGGCTGTCTGCCGGTGCAGTT
CCTCCAATCCAGGGTGAAGAAAGATATGATGGTGTGGCAACTACTGATGACAAATCTTCA
AATGTTCTTAGCATTCTTGGTAATGCAGTACATACAGCTGGTATGATTGAGCCTGTTCCA
GGCTCAGCTAGTGATGATGACAATGATGCCGGAGGAGGGAGACCTTACCCTGGAGATGAT
GCTGTTGAGGATGATGATTTAGAGTCAAAACGAAGGAAAATGGAATCTGCTGCTATTGAT
GCTGCTTTGATGGGCAAGCCTAACCGTGAGCCTCGTGTTGTAGTACAAACGGTTAGTGAG
GTTGACATCTTGGATGATGGGTACCGCTGGCGCAAGTATGGCCAGAAAGTAGTTAAAGGA
AACCCCAATCCACGGAGTTACTACAAGTGCACAAATACAGGATGCCCAGTCAGGAAGCAT
GTTGAGAGAGCATCACATGATCCAAAATCAGTCATAACAACATATGAAGGAAAACATAAC
CATGAAGTCCCTGCGTCGAGGAATGCGAGCCATGAGATGTCCACTCCCCCCATGAAGCCT
GTTGTCCATCCAATTAACAGCAATATGCAGGGCCTTGGTGGCATGATGAGAGCATGTGAA
CCTAGGACATTTCCAAACCAATATTCTCAAGCAGCTGAAAGTGACACCATCAGCCTTGAT
CTTGGTGTTGGAATCAGCCCGAACCACAGCGATGCCACAAACCAATTGCAGTCCTCAGTT
TCTGATCAGATGCAGTATCAAATGCAGCCCATGGGTTCAGTATACAGTAATATGGGACTT
CCAGCAATGGCAATGCCGACTATGGCTGGCAATGCAGCTAGCAATATATATGGTTCGAGA
GAAGAAAAACCTAGTGAAGGTTTTACTTTCAAAGCCACACCGATGGACCATTCGGCTAAC
TTATGCTACAGTACCGCCGGCAATTTAGTCATGGGTCCGTGAGAGTCTATACTAATGCTT
ATAGCTCGAGAATCATATATTACCAATGCTTCGTATTGACATTCTCTTCAGAAAGATGCT
CCTATCATTGACACATCAGTTGAACCGGAGGCGAGAGCTGTACCTGTGGGCTGCAGCAAA
ATACACCACATGGGTCTTCTGGAGCGGCAAAGGCCTTGTTGTATACTTGTATGTGGCACT
GGCCCTATATTCGTTGTACAGTGAACCCGTTAAGATTAATTAGATCATCAGAATTTGGTT
TTCTTTAACTATCTTCGCCTTCAGTGGAATGTGGATAGAACATGGATTATGGTTGATTTG
GTTTTGTGAGCTTGTCTAATTCTCTTTTGTGACAAAGCTTTGTATCTCACTGCATATGTA
CAATGCCGTTGGCAGTAAAGATATGCAAATGTGATACCTGTAACACG

CDS

1857 bp

>Os07t0583700-01 WRKY transcription factor, Regulation of stem elongation and seed development
ATGGCCGATTCGCCAAACCCTAGCTCCGGTGACCACCCCGCGGGCGTCGGCGGGTCGCCG
GAGAAGCAGCCCCCGGTGGATCGGCGCGTCGCGGCGCTCGCCGCGGGCGCGGCGGGCGCG
GGGGCGAGGTACAAGGCGATGTCCCCCGCGCGGCTGCCGATCTCGCGGGAGCCCTGCCTC
ACCATCCCCGCGGGCTTCAGCCCCTCGGCTCTCCTCGAGTCCCCCGTCCTCCTCACCAAC
TTCAAGGTTGAACCCTCTCCGACAACTGGTACTCTGAGCATGGCTGCAATTATGAACAAG
AGTGCAAATCCAGACATACTTCCTTCGCCTAGGGATAAAACATCTGGTAGCACCCATGAA
GATGGTGGCTCTCGAGATTTTGAATTCAAGCCTCATCTGAATTCATCCTCTCAATCGACG
GCTTCTGCTATCAATGATCCCAAAAAGCATGAAACTTCTATGAAAAATGAAAGCCTGAAT
ACTGCCCTGTCATCTGACGATATGATGATCGACAATATACCTCTATGTTCTCGTGAGTCA
ACTCTCGCAGTCAATATTTCAAGTGCCCCGAGCCAACTGGTTGGAATGGTTGGTTTAACT
GACAGCTCACCTGCTGAAGTTGGTACATCTGAGTTGCATCAGATGAATAGCTCTGGAAAT
GCTATGCAGGAGTCACAGCCTGAAAGTGTGGCTGAAAAGTCTGCAGAGGATGGTTATAAC
TGGCGCAAATATGGGCAAAAGCATGTTAAGGGAAGTGAGAACCCGAGAAGCTATTACAAG
TGCACACATCCTAACTGTGATGTAAAAAAGCTATTGGAGCGTTCGCTTGATGGTCAGATT
ACTGAAGTGGTTTATAAAGGGCGTCACAATCACCCTAAGCCCCAACCCAATAGGAGGCTG
TCTGCCGGTGCAGTTCCTCCAATCCAGGGTGAAGAAAGATATGATGGTGTGGCAACTACT
GATGACAAATCTTCAAATGTTCTTAGCATTCTTGGTAATGCAGTACATACAGCTGGTATG
ATTGAGCCTGTTCCAGGCTCAGCTAGTGATGATGACAATGATGCCGGAGGAGGGAGACCT
TACCCTGGAGATGATGCTGTTGAGGATGATGATTTAGAGTCAAAACGAAGGAAAATGGAA
TCTGCTGCTATTGATGCTGCTTTGATGGGCAAGCCTAACCGTGAGCCTCGTGTTGTAGTA
CAAACGGTTAGTGAGGTTGACATCTTGGATGATGGGTACCGCTGGCGCAAGTATGGCCAG
AAAGTAGTTAAAGGAAACCCCAATCCACGGAGTTACTACAAGTGCACAAATACAGGATGC
CCAGTCAGGAAGCATGTTGAGAGAGCATCACATGATCCAAAATCAGTCATAACAACATAT
GAAGGAAAACATAACCATGAAGTCCCTGCGTCGAGGAATGCGAGCCATGAGATGTCCACT
CCCCCCATGAAGCCTGTTGTCCATCCAATTAACAGCAATATGCAGGGCCTTGGTGGCATG
ATGAGAGCATGTGAACCTAGGACATTTCCAAACCAATATTCTCAAGCAGCTGAAAGTGAC
ACCATCAGCCTTGATCTTGGTGTTGGAATCAGCCCGAACCACAGCGATGCCACAAACCAA
TTGCAGTCCTCAGTTTCTGATCAGATGCAGTATCAAATGCAGCCCATGGGTTCAGTATAC
AGTAATATGGGACTTCCAGCAATGGCAATGCCGACTATGGCTGGCAATGCAGCTAGCAAT
ATATATGGTTCGAGAGAAGAAAAACCTAGTGAAGGTTTTACTTTCAAAGCCACACCGATG
GACCATTCGGCTAACTTATGCTACAGTACCGCCGGCAATTTAGTCATGGGTCCGTGA

Protein

618 aa

>Os07t0583700-01 WRKY transcription factor, Regulation of stem elongation and seed development
MADSPNPSSGDHPAGVGGSPEKQPPVDRRVAALAAGAAGAGARYKAMSPARLPISREPCL
TIPAGFSPSALLESPVLLTNFKVEPSPTTGTLSMAAIMNKSANPDILPSPRDKTSGSTHE
DGGSRDFEFKPHLNSSSQSTASAINDPKKHETSMKNESLNTALSSDDMMIDNIPLCSRES
TLAVNISSAPSQLVGMVGLTDSSPAEVGTSELHQMNSSGNAMQESQPESVAEKSAEDGYN
WRKYGQKHVKGSENPRSYYKCTHPNCDVKKLLERSLDGQITEVVYKGRHNHPKPQPNRRL
SAGAVPPIQGEERYDGVATTDDKSSNVLSILGNAVHTAGMIEPVPGSASDDDNDAGGGRP
YPGDDAVEDDDLESKRRKMESAAIDAALMGKPNREPRVVVQTVSEVDILDDGYRWRKYGQ
KVVKGNPNPRSYYKCTNTGCPVRKHVERASHDPKSVITTYEGKHNHEVPASRNASHEMST
PPMKPVVHPINSNMQGLGGMMRACEPRTFPNQYSQAAESDTISLDLGVGISPNHSDATNQ
LQSSVSDQMQYQMQPMGSVYSNMGLPAMAMPTMAGNAASNIYGSREEKPSEGFTFKATPM
DHSANLCYSTAGNLVMGP*

5'UTR

chr07:23659565..23659609 (- strand) : 45 bp

CDS

chr07:23659319..23659564 (- strand) : 246 bp

chr07:23658085..23658258 (- strand) : 174 bp

chr07:23656538..23657081 (- strand) : 544 bp

chr07:23655771..23655936 (- strand) : 166 bp

chr07:23655526..23655684 (- strand) : 159 bp

chr07:23654562..23655129 (- strand) : 568 bp

3'UTR

chr07:23654137..23654561 (- strand) : 425 bp

FASTA

>Os07t0583700-01 class=Sequence position=chr07:23654137..23659609 (- strand)
ACTCTCACGA GACAGCTTCC CACGCAGCGC AGCGCAACCG CAGCAATGGC CGATTCGCCA AACCCTAGCT CCGGTGACCA
CCCCGCGGGC GTCGGCGGGT CGCCGGAGAA GCAGCCCCCG GTGGATCGGC GCGTCGCGGC GCTCGCCGCG GGCGCGGCGG
GCGCGGGGGC GAGGTACAAG GCGATGTCCC CCGCGCGGCT GCCGATCTCG CGGGAGCCCT GCCTCACCAT CCCCGCGGGC
TTCAGCCCCT CGGCTCTCCT CGAGTCCCCC GTCCTCCTCA CCAACTTCAA GGTGAGCTGT GTACCTCGGC CGCGCGTGTA
GCGTAGCTAT CACCCACCCA TCTCCTCGCG CCTAGTTACT GCGGGATCTA CGAATTTCTT CGGCGCCCGC ATCGTGCCGG
GGGATTAATC TGTGTCGGGG GGGAAAGGAG GGATTCCGAT GCGCGCATTA GCTTTATGCT TCTAGTTTAT GAGACATTTG
CACCGCGGAA TTGGCTCGTG GCGTCGGAAT AATGCGCTTT TGCTGCGCGC TTTCGCATTT CTGGTGGTGC CTTGCGGTTT
CTGGAACTGA CTTTTGGCGG GGTTCGCGCG GATATAGTTG TTTTTGCTCT GTTTCTCCTT TTGGGGCGCC CCTGCGCCGT
CAATTTTCTG TGGAGTGAGG TGGGAGCTGT TGTTTGTGCG TTTCGGGGGA ATTATTCTGT GCTGCACACA CTTGGTGGCT
CGGGGGAACA AATCATCATG TGGCATTTTT CTTGTTGCGG CCTCAAAGGG CCTTACATAA GGAAACGCCC CCTTGGCTTT
GGCTGCTATT GTGCTGGTGG TGTGCATGCT AAGGAATGCT GCTGTTTCGT AAGGGAAGCA CCAAGCACTG CAAGAGAGTT
AGTTTATAGG CTTGGTTTAG AAATGATTGC TTCACTGATA TCGAGTGCTG GGTCTGGCCT TAGGTGTTGT ATTGGCGGTT
CTGATTCTTC TCGGTGAAAA CCCACAAATT GGAATTTACT TGCTGAGCAT AGAGTGCTTG TTTGCAGCTT CATATCACTT
GCTTTCTCTT GGTTCCTTCG TTACTTTGCC GACCTTCTTG ATGTTTCCTT TTCCAAAACA TAGGGATGCT TGGCAAACAG
GTTTTAATTA AATGAAGAAT TTATGAAGGT AACATTTAGT TGACAAGTGT TTCTGGATAA TTTTTCATAC TAGAGGCATA
AGTATTGTAC TAAGCATGAC ATAAATACTT TCTGCAAGTT ACTGTTCAAC ATGTACACTG TAATACTGTT GCGCATTGTT
GAATGTTCAA AAAATTATAG AGATTATGCT TACCTTGCTT GCAAACTAAT TATCAAAATT TCCCTGTTTA GGTTGAACCC
TCTCCGACAA CTGGTACTCT GAGCATGGCT GCAATTATGA ACAAGAGTGC AAATCCAGAC ATACTTCCTT CGCCTAGGGA
TAAAACATCT GGTAGCACCC ATGAAGATGG TGGCTCTCGA GATTTTGAAT TCAAGCCTCA TCTGAATTCA TCCTCTCAAT
CGACGGTATG GATCCTTTCT TTGAGTGATT ACCTGGTATC GTGTAATTCT TCATTTGTGT ATACTGTATT TGAGAGTTTG
AAAAAATTTC CATAGAAAAT AATAACATTT GTTGTTTACA AATGGTCCCG CCAAAACAGT GGAATTTATA TTGGGGATGT
ACATAAAAGG AGTGTAAAGT TCTAATGTGC TTATGCTAAC TTCCTTTCCA TGATCTAAAG TTGTTACCTT ACGGTATGCT
ATTTATTGGA TCTATATTGC ATTTTACTTG GTAAATCTAT CTGAGGTTCC AGCTTTTGAT ATTTAAGTTT TCCTATGTTT
AATTCAAAAT ATTCTCACGT GAATCGCAAA CCTCACCAGG AGTACAATAA ATTCGTTTTA TTATTATTGT AGGCTGTGTT
ATTTCTAGTC CATGGTTCGG TGTCTTGAAA TTTCAGTGCC AAAATTGGGA TGGATCTGGT TACATCTTCA AGTCTAATAA
ATGATCACAC CGACTTTATT GTGTGATTTG ATTATAGCAG GGTCTTGCAA CATAAATACA AGCTATTAAT TGTGAAAGGA
GAAATGAGAT CTTTGGTGAG ATCATGAGAA TAGGGTATAA CAGACACAAT ATTTCCTTGC TAGGTGAGAC TTGAGTGGTG
CTAGTCTGGC TGCAAATTTA TAGAAGTATG TGAAAATTTG AGGTCAGAAT ACAAGTAATT GAATGGACCA ATCTAATGAG
TTCTGTAGCT TTAGAATAAT TAATGTTAAC ATAAAAATAT GTTCATGAAA TCAGGTCCTT CTGCATTTTG TTGTTAACCG
AATTCCACAT TCTTCTTTAG TTCTCACAAG TACAGACAAG TATCTTGTAA TGGTGGATTC TTTTTTGGAA AACAAACTTC
ATTACATATT TTGTGTGATC CATCTATGCC TTGTGCCCTT GTTACCTTTT TTTCCCTACA CCTTGTTTTC TCTTGTACTT
AGTTTTGCAT TGTATAACCT TTTGCTGTAC TCGTGTCTTG TACTGTAGGC TTCTGCTATC AATGATCCCA AAAAGCATGA
AACTTCTATG AAAAATGAAA GCCTGAATAC TGCCCTGTCA TCTGACGATA TGATGATCGA CAATATACCT CTATGTTCTC
GTGAGTCAAC TCTCGCAGTC AATATTTCAA GTGCCCCGAG CCAACTGGTT GGAATGGTTG GTTTAACTGA CAGCTCACCT
GCTGAAGTTG GTACATCTGA GTTGCATCAG ATGAATAGCT CTGGAAATGC TATGCAGGAG TCACAGCCTG AAAGTGTGGC
TGAAAAGTCT GCAGAGGATG GTTATAACTG GCGCAAATAT GGGCAAAAGC ATGTTAAGGG AAGTGAGAAC CCGAGAAGCT
ATTACAAGTG CACACATCCT AACTGTGATG TAAAAAAGCT ATTGGAGCGT TCGCTTGATG GTCAGATTAC TGAAGTGGTT
TATAAAGGGC GTCACAATCA CCCTAAGCCC CAACCCAATA GGAGGCTGTC TGCCGGTGCA GTTCCTCCAA TCCAGGGTGA
AGAAAGATAT GATGGTGTGG CAACTACTGA TGGTGAGGGT TTTATCCTTT GTTTTAAAAA CTGATGCTGG ATCCCTCTGG
TTTGGCAGCT TGACCTCCTG CTTCTTGGAT CTGATTCCCC CCCTTTTTTT TGTGAATTCT CTTGCTATTT ATGTCATCTC
TGAACTTCTT ATTGCTTCTC AAGAATTTCT TGCAGAATTA TGATTCATAT TCCTTTAGAT TCTTAAAAAA ATGAATGATT
TGACATATAA AACAGCGAAT GAACGTATAG CGTGGTGGTA GAGCCTCCAA TAGTGGGGAC GCCGAGTCAC CGACCTAAGC
TCGAACCCAG GTTTTGCACC AAAAAACTCC CCTGCATGAG GTTGAGTGCA GCCTGGCTGT GCACTGCGTT TGGGTGGTTT
TTTTTCTCAA CTTAGTTGAA TTCCACGGGC CATTTTAACC TGCCAATCAT TTTTTTTTGT AACATACAAA ACAAAATTTG
ATAAGAGTTT TCTGAGCTGT ATTTGCACTC CAGTACATCA CTGCTGGTAT ATTTTTGCCA GTCCATACAC CGAAGGAAAA
GTCGTGTGAT ATGGATGAAT GTTTTTGTTG TGTTCTTTTA TGCGATTTTT AAATGTTATG TTTTTATATG CAGACAAATC
TTCAAATGTT CTTAGCATTC TTGGTAATGC AGTACATACA GCTGGTATGA TTGAGCCTGT TCCAGGCTCA GCTAGTGATG
ATGACAATGA TGCCGGAGGA GGGAGACCTT ACCCTGGAGA TGATGCTGTT GAGGATGATG ATTTAGAGTC AAAACGAAGG
TGCAGTTCAT TTGAACTTGT TACACACTAG GGCGAGAATC ACCCATTTAT ACTACTGAAT GTGTTGTTTA CAACTGTTCA
AACAGGAAAA TGGAATCTGC TGCTATTGAT GCTGCTTTGA TGGGCAAGCC TAACCGTGAG CCTCGTGTTG TAGTACAAAC
GGTTAGTGAG GTTGACATCT TGGATGATGG GTACCGCTGG CGCAAGTATG GCCAGAAAGT AGTTAAAGGA AACCCCAATC
CACGGTTAGT TGTTATTTTC TTCATCTATT GCTCCTAGTA AATTCTCCTC TTTTTTTCTC TGACATGTCA ACAGATTTTT
AACAGTAACA ACAAAATGTT CAATAATCTT CTGGTCATGT TATTTTAAAT CAGAAAGATA AGATTTTTTT GCCTTATACA
TATTTGTAAA ACATGTGTGT CGGATTGTCC GGTGATACTG CTGGGGAGTA AGGCTGTAGG GGCTTAATGC TAAGACTGGG
ATGCCGGGCA TCACTTAATT GGAAATTAGG CCTTCTCTTA AGGCTCTAAT GGTTCAATAT AATCAGATAT TTTCCATCAC
TTATTGAATA GGTGTATGTG TCCATAACCC ATATATATAC AGGATGCAAC TTGTATATTC ATTTTATTTC ATGATTGCAG
GAGTTACTAC AAGTGCACAA ATACAGGATG CCCAGTCAGG AAGCATGTTG AGAGAGCATC ACATGATCCA AAATCAGTCA
TAACAACATA TGAAGGAAAA CATAACCATG AAGTCCCTGC GTCGAGGAAT GCGAGCCATG AGATGTCCAC TCCCCCCATG
AAGCCTGTTG TCCATCCAAT TAACAGCAAT ATGCAGGGCC TTGGTGGCAT GATGAGAGCA TGTGAACCTA GGACATTTCC
AAACCAATAT TCTCAAGCAG CTGAAAGTGA CACCATCAGC CTTGATCTTG GTGTTGGAAT CAGCCCGAAC CACAGCGATG
CCACAAACCA ATTGCAGTCC TCAGTTTCTG ATCAGATGCA GTATCAAATG CAGCCCATGG GTTCAGTATA CAGTAATATG
GGACTTCCAG CAATGGCAAT GCCGACTATG GCTGGCAATG CAGCTAGCAA TATATATGGT TCGAGAGAAG AAAAACCTAG
TGAAGGTTTT ACTTTCAAAG CCACACCGAT GGACCATTCG GCTAACTTAT GCTACAGTAC CGCCGGCAAT TTAGTCATGG
GTCCGTGAGA GTCTATACTA ATGCTTATAG CTCGAGAATC ATATATTACC AATGCTTCGT ATTGACATTC TCTTCAGAAA
GATGCTCCTA TCATTGACAC ATCAGTTGAA CCGGAGGCGA GAGCTGTACC TGTGGGCTGC AGCAAAATAC ACCACATGGG
TCTTCTGGAG CGGCAAAGGC CTTGTTGTAT ACTTGTATGT GGCACTGGCC CTATATTCGT TGTACAGTGA ACCCGTTAAG
ATTAATTAGA TCATCAGAAT TTGGTTTTCT TTAACTATCT TCGCCTTCAG TGGAATGTGG ATAGAACATG GATTATGGTT
GATTTGGTTT TGTGAGCTTG TCTAATTCTC TTTTGTGACA AAGCTTTGTA TCTCACTGCA TATGTACAAT GCCGTTGGCA
GTAAAGATAT GCAAATGTGA TACCTGTAAC ACG

Locus: Os07g0583700

Loading...

Locus: Os07g0583700

Loading...