Os07t0585700-01

Locus

Os07g0585700

Description

Zinc finger protein, Pre-harvest sprouting resistance

RAP-DB Gene Symbol Synonym(s)

SDR4, Sdr4, OsSdr4, OsSdr4-n, OsSdr4-k

RAP-DB Gene Name Synonym(s)

SEED DORMANCY 4

CGSNL Gene Symbol

SDR4

CGSNL Gene Name

SEED DORMANCY 4

Oryzabase Gene Symbol Synonym(s)

Sdr4, OsSdr4, OsSdr4-n, OsSdr4-k, OsSdr4L, Sdr4L

Oryzabase Gene Name Synonym(s)

Sdr4-like

Transcript Evidence

AB510199 (DDBJ)

Protein Evidence

Q8H5K8 (UniProt)

Literature

PMID: 20220098

Note

Manual Curation

April 19, 2010

Expression Databases

TENOR (Os07t0585700-01)

Others

Oryzabase (8787)

Transcript

1032 bp

>Os07t0585700-01 Zinc finger protein, Pre-harvest sprouting resistance
ATGGCCATGGTGCAGCCGGTGGACATGGCCGTGAAGGCCAACGAGATCATGGCGAGGTTC
AGGCCCATCGCGCCCAAGCCCGTGCTGCCGGCGGCGGCGGCGGGGGTGACGGGTGGTGGT
GACGGTGCTGCGGCGGTGGCGGCGACGAACCGCGTGCTCTGCCAGCTGCAGAGCAGGCCG
TGCCGGGCGCGGAAGCGGGGGCGGCCCAGCGTAGTGCCGCCGGTGTCCCCGCCGGCGGGG
GCCAAGAGGAAGAGGGCGCCGGCGTACCCGGTCCCCGTGGCGCCGCTCCGGTGCGCGGCG
GTGGCCACGGCGACGAGGGCGCGCGTGTCGGTGGTGGTCGTCCCGGCCCCGGAGAGTGCG
GGCGGGGTTAGTGCGCTGGCGCCGGTGTCGCCGAGTGCCGGGGACTCGACGAGGCTCTCG
CCGACGGTGGTGGAGGTGGAGGACGAGGACGAGGAGAGGGGCGTGGTGCTCGTGGAGCGC
GACCTGCTGCGGAAGCTGCTGGAGCCGCGGAAGCTGCTGGAGCCGCGCGCGGTGCGCCCC
GTGGGCTCCACCATCCACGTCGAGTCAGTCCACATCGACGTCGGCCGCACCACCGCCGCC
GCCGCCGCAGCCGCCCCGAAGACGGCGGAGGAGGTGGAGGCGGAGCTGGAGTCGGACTCC
CTCCCGGCGGTGGTCTCGGACTCCAGCAACCGCGTCCGGCTGGTGAACGACGCGTACAAG
CGAATGGTGGGGCAGCCCGAGTGCCCGTGGCTCGACGCCGTGGCCACCGCCGCGTCCAGG
AGGATCAGCGGCGAGGTGGCGCTGGTAGTGTCCGAGCCGGCGGCGGCGGCGGCGGCGCTG
CCGGAGACATGCAAGGGGTTCTCGTGCTCGGCCAAGATCGCGTGGGAGCGCGACGGCAAG
TGGTCATCCGTCCATGCACCGTGCGACGTCACCCGGCTGCAGTGCGAGTCGAGGGACTAC
GTCTTCGCCTGGAGGTTCCGCGCCGCCGGCGACGAATGCAACACCCACCGCCGCGCCGCC
GGCGACGCGTGA

CDS

1032 bp

>Os07t0585700-01 Zinc finger protein, Pre-harvest sprouting resistance
ATGGCCATGGTGCAGCCGGTGGACATGGCCGTGAAGGCCAACGAGATCATGGCGAGGTTC
AGGCCCATCGCGCCCAAGCCCGTGCTGCCGGCGGCGGCGGCGGGGGTGACGGGTGGTGGT
GACGGTGCTGCGGCGGTGGCGGCGACGAACCGCGTGCTCTGCCAGCTGCAGAGCAGGCCG
TGCCGGGCGCGGAAGCGGGGGCGGCCCAGCGTAGTGCCGCCGGTGTCCCCGCCGGCGGGG
GCCAAGAGGAAGAGGGCGCCGGCGTACCCGGTCCCCGTGGCGCCGCTCCGGTGCGCGGCG
GTGGCCACGGCGACGAGGGCGCGCGTGTCGGTGGTGGTCGTCCCGGCCCCGGAGAGTGCG
GGCGGGGTTAGTGCGCTGGCGCCGGTGTCGCCGAGTGCCGGGGACTCGACGAGGCTCTCG
CCGACGGTGGTGGAGGTGGAGGACGAGGACGAGGAGAGGGGCGTGGTGCTCGTGGAGCGC
GACCTGCTGCGGAAGCTGCTGGAGCCGCGGAAGCTGCTGGAGCCGCGCGCGGTGCGCCCC
GTGGGCTCCACCATCCACGTCGAGTCAGTCCACATCGACGTCGGCCGCACCACCGCCGCC
GCCGCCGCAGCCGCCCCGAAGACGGCGGAGGAGGTGGAGGCGGAGCTGGAGTCGGACTCC
CTCCCGGCGGTGGTCTCGGACTCCAGCAACCGCGTCCGGCTGGTGAACGACGCGTACAAG
CGAATGGTGGGGCAGCCCGAGTGCCCGTGGCTCGACGCCGTGGCCACCGCCGCGTCCAGG
AGGATCAGCGGCGAGGTGGCGCTGGTAGTGTCCGAGCCGGCGGCGGCGGCGGCGGCGCTG
CCGGAGACATGCAAGGGGTTCTCGTGCTCGGCCAAGATCGCGTGGGAGCGCGACGGCAAG
TGGTCATCCGTCCATGCACCGTGCGACGTCACCCGGCTGCAGTGCGAGTCGAGGGACTAC
GTCTTCGCCTGGAGGTTCCGCGCCGCCGGCGACGAATGCAACACCCACCGCCGCGCCGCC
GGCGACGCGTGA

Protein

344 aa

>Os07t0585700-01 Zinc finger protein, Pre-harvest sprouting resistance
MAMVQPVDMAVKANEIMARFRPIAPKPVLPAAAAGVTGGGDGAAAVAATNRVLCQLQSRP
CRARKRGRPSVVPPVSPPAGAKRKRAPAYPVPVAPLRCAAVATATRARVSVVVVPAPESA
GGVSALAPVSPSAGDSTRLSPTVVEVEDEDEERGVVLVERDLLRKLLEPRKLLEPRAVRP
VGSTIHVESVHIDVGRTTAAAAAAAPKTAEEVEAELESDSLPAVVSDSSNRVRLVNDAYK
RMVGQPECPWLDAVATAASRRISGEVALVVSEPAAAAAALPETCKGFSCSAKIAWERDGK
WSSVHAPCDVTRLQCESRDYVFAWRFRAAGDECNTHRRAAGDA*

CDS

chr07:23796611..23797642 (+ strand) : 1032 bp

FASTA

>Os07t0585700-01 class=Sequence position=chr07:23796611..23797642 (+ strand)
ATGGCCATGG TGCAGCCGGT GGACATGGCC GTGAAGGCCA ACGAGATCAT GGCGAGGTTC AGGCCCATCG CGCCCAAGCC
CGTGCTGCCG GCGGCGGCGG CGGGGGTGAC GGGTGGTGGT GACGGTGCTG CGGCGGTGGC GGCGACGAAC CGCGTGCTCT
GCCAGCTGCA GAGCAGGCCG TGCCGGGCGC GGAAGCGGGG GCGGCCCAGC GTAGTGCCGC CGGTGTCCCC GCCGGCGGGG
GCCAAGAGGA AGAGGGCGCC GGCGTACCCG GTCCCCGTGG CGCCGCTCCG GTGCGCGGCG GTGGCCACGG CGACGAGGGC
GCGCGTGTCG GTGGTGGTCG TCCCGGCCCC GGAGAGTGCG GGCGGGGTTA GTGCGCTGGC GCCGGTGTCG CCGAGTGCCG
GGGACTCGAC GAGGCTCTCG CCGACGGTGG TGGAGGTGGA GGACGAGGAC GAGGAGAGGG GCGTGGTGCT CGTGGAGCGC
GACCTGCTGC GGAAGCTGCT GGAGCCGCGG AAGCTGCTGG AGCCGCGCGC GGTGCGCCCC GTGGGCTCCA CCATCCACGT
CGAGTCAGTC CACATCGACG TCGGCCGCAC CACCGCCGCC GCCGCCGCAG CCGCCCCGAA GACGGCGGAG GAGGTGGAGG
CGGAGCTGGA GTCGGACTCC CTCCCGGCGG TGGTCTCGGA CTCCAGCAAC CGCGTCCGGC TGGTGAACGA CGCGTACAAG
CGAATGGTGG GGCAGCCCGA GTGCCCGTGG CTCGACGCCG TGGCCACCGC CGCGTCCAGG AGGATCAGCG GCGAGGTGGC
GCTGGTAGTG TCCGAGCCGG CGGCGGCGGC GGCGGCGCTG CCGGAGACAT GCAAGGGGTT CTCGTGCTCG GCCAAGATCG
CGTGGGAGCG CGACGGCAAG TGGTCATCCG TCCATGCACC GTGCGACGTC ACCCGGCTGC AGTGCGAGTC GAGGGACTAC
GTCTTCGCCT GGAGGTTCCG CGCCGCCGGC GACGAATGCA ACACCCACCG CCGCGCCGCC GGCGACGCGT GA