Os07t0588400-01

Locus

Os07g0588400

Description

Root Hair Defective-Six Like (RSL) Class II family of transcription factor, Regulation of root hair development

RAP-DB Gene Symbol Synonym(s)

OsRSL6

RAP-DB Gene Name Synonym(s)

Root Hair Defective-Six Like 6

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH128, bHLH128, OsRSL6, RSL6, DLN190, OsDLN190

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 128, ROOT HAIR DEFECTIVE-SIX LIKE 6, DLN repressor 190, DLN motif protein 190

Transcript Evidence

XM_015790741

Protein Evidence

A0A0P0X817

Literature

PMID: 30545904

PMID: 27716929

Note

Manual Curation

September 2, 2019

Gene Ontology (GO)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

Helix-loop-helix DNA-binding domain superfamily (IPR036638)

Myc-type, basic helix-loop-helix (bHLH) domain (IPR011598)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Expression Databases

TENOR (Os07t0588400-00)

Others

Oryzabase (15406)

Transcript

1189 bp

>Os07t0588400-01 Root Hair Defective-Six Like (RSL) Class II family of transcription factor, Regulation of root hair development
ACTCAGCCATTGCAGCTGACTATAGCGGCAGCATCTCTCTAATTAAGCTAGTGCTTTTCT
TTGCCTTGAGGCCTTTTCACCTTGCTGAAATGGAGAGATCATACACATCAGCGGTGCCGT
TGATCGAGGCCGACGCGATGGCGCAGTTTCTTGGAGCTCATGGTGATCACTGCTTCACCT
ACGAGCAAATGGATGAGTCCATGGAGGCAATGGCAGCGATGTTCTTGCCTGGCCTTGACA
CCGACTCCAATTCTTCTTCTGGTTGTCTCAACTACGATGTGCCTCCACAATGCTGGCCTC
AGCATGGCCATAGCTCTAGCGTCACCAGCTTCCCTGATCCAGCTCATAGCTATGGAAGCT
TTGAGTTCCCGGTCATGGATCCGTTCCCGATCGCCGATCTCGACGCGCATTGCGCCATCC
CCTACCTTACTGAGGATCTGATCAGCCCTCCACATGGCAACCATCCATCAGCAAGAGTGG
AAGAAGCTACAAAGGTTGTTACACCAGTGGCTACCAAGAGGAAGTCTAGTGCTGCCATGA
CGGCATCAAAGAAGAGCAAGAAGGCTGGCAAAAAAGATCCTATTGGCAGCGACGAAGGCG
GCAACACCTACATTGATACGCAAAGTTCTAGCAGTTGCACCTCAGAGGAAGGAAACCTGG
AGGGCAACGCGAAGCCGAGCTCGAAGAAGATGGGTACTAGGGCCAACCGTGGGGCGGCAA
CCGATCCCCAGAGTCTCTATGCAAGGAAGAGGAGAGAGAGGATCAATGAAAGATTGAGGA
TCCTGCAGAACTTGGTTCCCAATGGAACAAAGGTTGACATCAGTACAATGCTGGAGGAAG
CAGTGCAGTATGTCAAATTTTTGCAACTTCAGATTAAGTTGCTAAGCTCTGATGACACGT
GGATGTATGCACCAATCGCTTACAATGGAGTCAACATCAGCAATATTGATCTGAACATCT
CTTCTCTGCAAAAATAATATCGCCTCGGATATACAGAGCTAACATTGAATTGCATAGAGA
TTAATTGATTCTGGCCCATATAGTCCCAAATATCATACATGTAATGTAACTTTATTCATT
TTTCTTCCTACTACTTGGCATTTACCATAAAGCCATAAGAAGAAGTAATCATGATCATGT
TAATGATCAAAGATCAAGTGATATGATTGACTTCCATTTGAGATGAGTA

CDS

888 bp

>Os07t0588400-01 Root Hair Defective-Six Like (RSL) Class II family of transcription factor, Regulation of root hair development
ATGGAGAGATCATACACATCAGCGGTGCCGTTGATCGAGGCCGACGCGATGGCGCAGTTT
CTTGGAGCTCATGGTGATCACTGCTTCACCTACGAGCAAATGGATGAGTCCATGGAGGCA
ATGGCAGCGATGTTCTTGCCTGGCCTTGACACCGACTCCAATTCTTCTTCTGGTTGTCTC
AACTACGATGTGCCTCCACAATGCTGGCCTCAGCATGGCCATAGCTCTAGCGTCACCAGC
TTCCCTGATCCAGCTCATAGCTATGGAAGCTTTGAGTTCCCGGTCATGGATCCGTTCCCG
ATCGCCGATCTCGACGCGCATTGCGCCATCCCCTACCTTACTGAGGATCTGATCAGCCCT
CCACATGGCAACCATCCATCAGCAAGAGTGGAAGAAGCTACAAAGGTTGTTACACCAGTG
GCTACCAAGAGGAAGTCTAGTGCTGCCATGACGGCATCAAAGAAGAGCAAGAAGGCTGGC
AAAAAAGATCCTATTGGCAGCGACGAAGGCGGCAACACCTACATTGATACGCAAAGTTCT
AGCAGTTGCACCTCAGAGGAAGGAAACCTGGAGGGCAACGCGAAGCCGAGCTCGAAGAAG
ATGGGTACTAGGGCCAACCGTGGGGCGGCAACCGATCCCCAGAGTCTCTATGCAAGGAAG
AGGAGAGAGAGGATCAATGAAAGATTGAGGATCCTGCAGAACTTGGTTCCCAATGGAACA
AAGGTTGACATCAGTACAATGCTGGAGGAAGCAGTGCAGTATGTCAAATTTTTGCAACTT
CAGATTAAGTTGCTAAGCTCTGATGACACGTGGATGTATGCACCAATCGCTTACAATGGA
GTCAACATCAGCAATATTGATCTGAACATCTCTTCTCTGCAAAAATAA

Protein

296 aa

>Os07t0588400-01 Root Hair Defective-Six Like (RSL) Class II family of transcription factor, Regulation of root hair development
MERSYTSAVPLIEADAMAQFLGAHGDHCFTYEQMDESMEAMAAMFLPGLDTDSNSSSGCL
NYDVPPQCWPQHGHSSSVTSFPDPAHSYGSFEFPVMDPFPIADLDAHCAIPYLTEDLISP
PHGNHPSARVEEATKVVTPVATKRKSSAAMTASKKSKKAGKKDPIGSDEGGNTYIDTQSS
SSCTSEEGNLEGNAKPSSKKMGTRANRGAATDPQSLYARKRRERINERLRILQNLVPNGT
KVDISTMLEEAVQYVKFLQLQIKLLSSDDTWMYAPIAYNGVNISNIDLNISSLQK*

5'UTR

chr07:23958317..23958405 (- strand) : 89 bp

CDS

chr07:23957864..23958316 (- strand) : 453 bp

chr07:23957564..23957767 (- strand) : 204 bp

chr07:23957412..23957477 (- strand) : 66 bp

chr07:23957230..23957295 (- strand) : 66 bp

chr07:23957016..23957114 (- strand) : 99 bp

3'UTR

chr07:23956804..23957015 (- strand) : 212 bp

FASTA

>Os07t0588400-01 class=Sequence position=chr07:23956804..23958405 (- strand)
ACTCAGCCAT TGCAGCTGAC TATAGCGGCA GCATCTCTCT AATTAAGCTA GTGCTTTTCT TTGCCTTGAG GCCTTTTCAC
CTTGCTGAAA TGGAGAGATC ATACACATCA GCGGTGCCGT TGATCGAGGC CGACGCGATG GCGCAGTTTC TTGGAGCTCA
TGGTGATCAC TGCTTCACCT ACGAGCAAAT GGATGAGTCC ATGGAGGCAA TGGCAGCGAT GTTCTTGCCT GGCCTTGACA
CCGACTCCAA TTCTTCTTCT GGTTGTCTCA ACTACGATGT GCCTCCACAA TGCTGGCCTC AGCATGGCCA TAGCTCTAGC
GTCACCAGCT TCCCTGATCC AGCTCATAGC TATGGAAGCT TTGAGTTCCC GGTCATGGAT CCGTTCCCGA TCGCCGATCT
CGACGCGCAT TGCGCCATCC CCTACCTTAC TGAGGATCTG ATCAGCCCTC CACATGGCAA CCATCCATCA GCAAGAGTGG
AAGAAGCTAC AAAGGTTGTT ACACCAGTGG CTACCAAGAG GAAGTCTAGT GCTGCCATGA CGGTATGCCC CTGCAAATAA
CTTAATAGAA CAGTGATCTA CTTCAGTTAC CATGCTGTTT TATTTTCCAT GCCTAATTGG ATTGATGAAC TGATACAGGC
ATCAAAGAAG AGCAAGAAGG CTGGCAAAAA AGATCCTATT GGCAGCGACG AAGGCGGCAA CACCTACATT GATACGCAAA
GTTCTAGCAG TTGCACCTCA GAGGAAGGAA ACCTGGAGGG CAACGCGAAG CCGAGCTCGA AGAAGATGGG TACTAGGGCC
AACCGTGGGG CGGCAACCGA TCCCCAGAGT CTCTATGCAA GGGTAAGTAC AAATAAAATA AAATGTGTAA AAAAAATGAC
AAAGTGATTC AAGGAATTCT GATGAGGTTA AATTTGTCCG TTCTACAGAA GAGGAGAGAG AGGATCAATG AAAGATTGAG
GATCCTGCAG AACTTGGTTC CCAATGGAAC AAAGGTAAGC TCAATATGAA ACTTAACTAC AGGCAATAAC TAAGTTTTTG
CCTCATACAT TTGAGCATGA TAATTGGTAC AAAGAAATTT GGGTGTAACT TGATAAGTAT GATCTGACAG GTTGACATCA
GTACAATGCT GGAGGAAGCA GTGCAGTATG TCAAATTTTT GCAACTTCAG ATTAAGGTGG GTACATTACA TATCATTGTC
ATCTAGCCAA GGATTGTTAA TAACCAAATT ATTTTTCTAT AAACAGTAAG TGAAATACCT TCCTAACTTT GCTGCAAACT
ATCATGTGCA GTTGCTAAGC TCTGATGACA CGTGGATGTA TGCACCAATC GCTTACAATG GAGTCAACAT CAGCAATATT
GATCTGAACA TCTCTTCTCT GCAAAAATAA TATCGCCTCG GATATACAGA GCTAACATTG AATTGCATAG AGATTAATTG
ATTCTGGCCC ATATAGTCCC AAATATCATA CATGTAATGT AACTTTATTC ATTTTTCTTC CTACTACTTG GCATTTACCA
TAAAGCCATA AGAAGAAGTA ATCATGATCA TGTTAATGAT CAAAGATCAA GTGATATGAT TGACTTCCAT TTGAGATGAG
TA

Locus: Os07g0588400

Loading...

Locus: Os07g0588400

Loading...