Os07t0588700-00

Locus

Os07g0588700

Description

Zinc finger, C2H2-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ZFP245

CGSNL Gene Name

ZINC FINGER PROTEIN 245

Oryzabase Gene Symbol Synonym(s)

OsZFP245

Oryzabase Gene Name Synonym(s)

zinc finger protein ZFP245

Transcript Evidence

AY395294 (DDBJ, Best hit)

Protein Evidence

A3BLP7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, C2H2 (IPR007087)

Zinc finger, C2H2-like (IPR015880)

Expression Databases

TENOR (Os07t0588700-00)

RiceXPro (AY395294)

Others

Oryzabase (8645)

KEGG (Os07t0588700-00)

Transcript

712 bp

>Os07t0588700-00 Zinc finger, C2H2-type domain containing protein.
GTCGATTTCATACCACTATGGGGCTAAACGAGAAGCCATTGGTGCCTCCGTTGTCTCCAA
CGCCGGTGGACTTCCGAGCCCATCAGGTGTTCCCATCCAAGCACCACGATTTTGACACTA
GCAAGAGTCGTAACATCTCTGGTAGTGTCGCCATCGGCAGTGATTCTGAGGAGGAGTACT
TGGCGACTTCTCTCTTGATGCTCGCACATGGCATTCGGGACGAGACCAAGGACATCCGAG
GGATGGGAGACGTAAAAGGTGTGGGTGTTGACACTTTGGAGCTGGTGAAACCAAGCCAAC
GGGCTTATGAGTGCTCGGTGTGTGGCAAGGTGTACTGGTGTTACCAGGCGTTGGGTGGGC
ACATGACGTGCCACCGCAACCTATTTGCACAAGTGGTGGCCGGTGATGAGTTGTCCTCCG
ATAGGACCATGGTGGTTAAGGGGCACAAGTGCTCTATCTGTCGCCTTGAGTTCCCATCTG
GGCAGGCGCTAGGAGGACACATGCGGGTGCACTATGTGGGTGGTGTTGAAGGAGGCTCTG
TCAAGGAGAAGAACGTTGTGAAGACCAAGGTTACAGGAGCACTGAAGCTAGTGTTGAAAG
ACTTTGACCTGAACGTGCCTGTTGTGGCAACGATGGTGGGAGACGAGGCTGAGAGCTCAC
ATTCAGAGGCCAAAGCGCGGATGATGACACTCCCCTAACCAGCGCAATACTT

CDS

681 bp

>Os07t0588700-00 Zinc finger, C2H2-type domain containing protein.
ATGGGGCTAAACGAGAAGCCATTGGTGCCTCCGTTGTCTCCAACGCCGGTGGACTTCCGA
GCCCATCAGGTGTTCCCATCCAAGCACCACGATTTTGACACTAGCAAGAGTCGTAACATC
TCTGGTAGTGTCGCCATCGGCAGTGATTCTGAGGAGGAGTACTTGGCGACTTCTCTCTTG
ATGCTCGCACATGGCATTCGGGACGAGACCAAGGACATCCGAGGGATGGGAGACGTAAAA
GGTGTGGGTGTTGACACTTTGGAGCTGGTGAAACCAAGCCAACGGGCTTATGAGTGCTCG
GTGTGTGGCAAGGTGTACTGGTGTTACCAGGCGTTGGGTGGGCACATGACGTGCCACCGC
AACCTATTTGCACAAGTGGTGGCCGGTGATGAGTTGTCCTCCGATAGGACCATGGTGGTT
AAGGGGCACAAGTGCTCTATCTGTCGCCTTGAGTTCCCATCTGGGCAGGCGCTAGGAGGA
CACATGCGGGTGCACTATGTGGGTGGTGTTGAAGGAGGCTCTGTCAAGGAGAAGAACGTT
GTGAAGACCAAGGTTACAGGAGCACTGAAGCTAGTGTTGAAAGACTTTGACCTGAACGTG
CCTGTTGTGGCAACGATGGTGGGAGACGAGGCTGAGAGCTCACATTCAGAGGCCAAAGCG
CGGATGATGACACTCCCCTAA

Protein

227 aa

>Os07t0588700-00 Zinc finger, C2H2-type domain containing protein.
MGLNEKPLVPPLSPTPVDFRAHQVFPSKHHDFDTSKSRNISGSVAIGSDSEEEYLATSLL
MLAHGIRDETKDIRGMGDVKGVGVDTLELVKPSQRAYECSVCGKVYWCYQALGGHMTCHR
NLFAQVVAGDELSSDRTMVVKGHKCSICRLEFPSGQALGGHMRVHYVGGVEGGSVKEKNV
VKTKVTGALKLVLKDFDLNVPVVATMVGDEAESSHSEAKARMMTLP*

5'UTR

chr07:23980540..23980556 (+ strand) : 17 bp

CDS

chr07:23980557..23981237 (+ strand) : 681 bp

3'UTR

chr07:23981238..23981251 (+ strand) : 14 bp

FASTA

>Os07t0588700-00 class=Sequence position=chr07:23980540..23981251 (+ strand)
GTCGATTTCA TACCACTATG GGGCTAAACG AGAAGCCATT GGTGCCTCCG TTGTCTCCAA CGCCGGTGGA CTTCCGAGCC
CATCAGGTGT TCCCATCCAA GCACCACGAT TTTGACACTA GCAAGAGTCG TAACATCTCT GGTAGTGTCG CCATCGGCAG
TGATTCTGAG GAGGAGTACT TGGCGACTTC TCTCTTGATG CTCGCACATG GCATTCGGGA CGAGACCAAG GACATCCGAG
GGATGGGAGA CGTAAAAGGT GTGGGTGTTG ACACTTTGGA GCTGGTGAAA CCAAGCCAAC GGGCTTATGA GTGCTCGGTG
TGTGGCAAGG TGTACTGGTG TTACCAGGCG TTGGGTGGGC ACATGACGTG CCACCGCAAC CTATTTGCAC AAGTGGTGGC
CGGTGATGAG TTGTCCTCCG ATAGGACCAT GGTGGTTAAG GGGCACAAGT GCTCTATCTG TCGCCTTGAG TTCCCATCTG
GGCAGGCGCT AGGAGGACAC ATGCGGGTGC ACTATGTGGG TGGTGTTGAA GGAGGCTCTG TCAAGGAGAA GAACGTTGTG
AAGACCAAGG TTACAGGAGC ACTGAAGCTA GTGTTGAAAG ACTTTGACCT GAACGTGCCT GTTGTGGCAA CGATGGTGGG
AGACGAGGCT GAGAGCTCAC ATTCAGAGGC CAAAGCGCGG ATGATGACAC TCCCCTAACC AGCGCAATAC TT