Os07t0592000-01

Locus

Os07g0592000

Description

A member of gibberellic acid (GA)-stimulated transcript gene family, Regulation of grain size and yield

RAP-DB Gene Symbol Synonym(s)

OsGASR9

RAP-DB Gene Name Synonym(s)

gibberellic acid-stimulated rice 9

CGSNL Gene Symbol

GASR9

CGSNL Gene Name

GIBBERELLIC ACID-STIMULATED RICE 9

Oryzabase Gene Symbol Synonym(s)

OsGASR9

Oryzabase Gene Name Synonym(s)

gibberellic acid-stimulated rice 9

Transcript Evidence

AK107438

Protein Evidence

Q0D500

Literature

PMID: 31300138

Note

Manual Curation

July 17, 2019

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

cytoplasm (GO:0005737)

nucleus (GO:0005634)

Full-length cDNA

002-128-B02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0592000-01)

RiceXPro (AK107438)

Others

Oryzabase (23131)

KEGG (Os07t0592000-01)

Transcript

2054 bp

>Os07t0592000-01 A member of gibberellic acid (GA)-stimulated transcript gene family, Regulation of grain size and yield
ACAGCTCACTACCTATCCATCTAAAATCTGATTACACATTTGCCCATTAAATTCTACTAT
GCACAACAAGAAGCCACGAATTCTACTATGCACAACAAGAAGCCACGACTGTGCTCTTAA
TTCAAATCTGAATTTGTTAGGACATATTATTGACGTATAACCACATAAATAAATCCAAAG
TATATATAATATTTTTGTTTCCCCATTTCAAGGTCTATATGATCTTACTTATTTGGTTTT
GGTCCGCATACTGGTAGTATGCCTGAGAGTGGTTATATTGATGACTGTTAAGAGAATGAC
AAGTCAATATCTTGCTTTGATACCTTTTTTTTTGCATTTTTGATTTAGCTAAAAATAACT
ATGTACTGATAATGGTTATTTTTATTGTTACAAATTCCAATTACATGAGGATATGTTTTA
TAAATTTTGGGTAAATAGGTTGTGCTTCAGAAGGTGTAGTTTCTAAAATTTTTAGTGCAA
TTATGTACTCGGGCGATATATTTTGTCAAAAAACGTGCATTGCACGTGAGTATTAGTAGT
GTGTTACTGTGTTACAGTCCATTGCATAGACCATTGGGCACACACACGCTGATAAGCACA
AGATCCAAAAGCAAGTAACCGCCCATGGTATACTATGCATGTACGAGGCCGACAAAAGGG
AAAGCAAGCCGGTGATGCGCGTGAACACTGCGGCATAGCGACAAGGCCACCTGTCCGCCA
TGGCATTCATGATTCATGGCCGTCCCTCCCCCTGCGAGATTCCCCCACTCACTTGCTCAC
ACACCAAAGAAGCTACTGGGGCAGGTGTGTCCATTGAATTGAATTGAATTGAAACTATTG
ATGAATGAATTCACCAGCCAGCTAGAACCTTCCTTGAAACCAGCCATAAATCACACCCAT
TCATCTCTCTCAACTCTCTGCAGCCCATTCACTGCACCAGTGTAGTAGCAGTGCTGCAGT
TGCTTTGAACACTCATCTCCTCACCGTGTTTGTTAGAGCTCAAAAGGATCAAGAGAAGAT
GAGGGTTCCTCCTCTTCGTGCCACCACGGCTCTCCTGGCCACCCTCCTGGTCGCCGCCTC
GTTCCAGGATCTCACCGTCGCTGCAGACGGCGGCGGCGGCGTGGTTCCGGTCCCGGATAG
CGTGTGCGACGCCAAGTGCCAGAAGCGGTGCTCGCTGAAGGTGGCCGGGCGGTGCATGGG
GCTGTGCAAGATGTGCTGCCACGACTGCGGCGGCTGCGTGCCGTCGGGGCCGTACGCCAG
CAAGGACGAGTGCCCCTGCTACCGCGACATGGTCTCCCCCAAGAGCCGACGGCCCAAGTG
CCCGTGAGCAACGAGAGATGGCTGGCACTGTGACGATGTGTAGCCGATCCGTGGTAGTAG
TGTGATTGATAGCGTTGGGATCGATCTCGGTTCTTTGAGAAGTGTTAGTGCTTAGTGGAA
TAAAACAAGAATGTCTGTCTAAGATATGTCTTGTGCTTTGTCCAGAGTATGCTCTGATAT
CGCTCTGATATCTaggccgagtttagttccaaattttttcttcaaactttcaactttttt
atcacatcaaaactttcctacaacacaaatttctaatttttccattatatcgttccaatt
tcaaccaaatttccaattttagcgtgaactaaacacacAAGTTACTTTTGATTATTTTTT
TTAAGCAACAGAATTGAGAAtgagggtgtgtttagttcacgctaaaattgaaagttttat
tgagattggaacgatgtaacggaaaagttagaagtttatgtatatagaaaattaaagttc
tgatgtgatggaaaacttggaggtttaaagaaaaagttgggaactaaaccagacctGGAT
CATCTGGCTCGAgcaggggcggagctagtatatattaggggggtgcccagaaacctggtc
aagaaaattttttagctatacctcatctattttcatcatgtatgtaccctctaaatacaa
acttaggcatccgcatcagcttaaacttgatctaaagtagagtaaattaaacaagtgaca
ccaccatctatttc

CDS

309 bp

>Os07t0592000-01 A member of gibberellic acid (GA)-stimulated transcript gene family, Regulation of grain size and yield
ATGAGGGTTCCTCCTCTTCGTGCCACCACGGCTCTCCTGGCCACCCTCCTGGTCGCCGCC
TCGTTCCAGGATCTCACCGTCGCTGCAGACGGCGGCGGCGGCGTGGTTCCGGTCCCGGAT
AGCGTGTGCGACGCCAAGTGCCAGAAGCGGTGCTCGCTGAAGGTGGCCGGGCGGTGCATG
GGGCTGTGCAAGATGTGCTGCCACGACTGCGGCGGCTGCGTGCCGTCGGGGCCGTACGCC
AGCAAGGACGAGTGCCCCTGCTACCGCGACATGGTCTCCCCCAAGAGCCGACGGCCCAAG
TGCCCGTGA

Protein

102 aa

>Os07t0592000-01 A member of gibberellic acid (GA)-stimulated transcript gene family, Regulation of grain size and yield
MRVPPLRATTALLATLLVAASFQDLTVAADGGGGVVPVPDSVCDAKCQKRCSLKVAGRCM
GLCKMCCHDCGGCVPSGPYASKDECPCYRDMVSPKSRRPKCP*

5'UTR

chr07:24125333..24126350 (+ strand) : 1018 bp

CDS

chr07:24126351..24126438 (+ strand) : 88 bp

chr07:24126540..24126760 (+ strand) : 221 bp

3'UTR

chr07:24126761..24127487 (+ strand) : 727 bp

FASTA

>Os07t0592000-01 class=Sequence position=chr07:24125333..24127487 (+ strand)
ACAGCTCACT ACCTATCCAT CTAAAATCTG ATTACACATT TGCCCATTAA ATTCTACTAT GCACAACAAG AAGCCACGAA
TTCTACTATG CACAACAAGA AGCCACGACT GTGCTCTTAA TTCAAATCTG AATTTGTTAG GACATATTAT TGACGTATAA
CCACATAAAT AAATCCAAAG TATATATAAT ATTTTTGTTT CCCCATTTCA AGGTCTATAT GATCTTACTT ATTTGGTTTT
GGTCCGCATA CTGGTAGTAT GCCTGAGAGT GGTTATATTG ATGACTGTTA AGAGAATGAC AAGTCAATAT CTTGCTTTGA
TACCTTTTTT TTTGCATTTT TGATTTAGCT AAAAATAACT ATGTACTGAT AATGGTTATT TTTATTGTTA CAAATTCCAA
TTACATGAGG ATATGTTTTA TAAATTTTGG GTAAATAGGT TGTGCTTCAG AAGGTGTAGT TTCTAAAATT TTTAGTGCAA
TTATGTACTC GGGCGATATA TTTTGTCAAA AAACGTGCAT TGCACGTGAG TATTAGTAGT GTGTTACTGT GTTACAGTCC
ATTGCATAGA CCATTGGGCA CACACACGCT GATAAGCACA AGATCCAAAA GCAAGTAACC GCCCATGGTA TACTATGCAT
GTACGAGGCC GACAAAAGGG AAAGCAAGCC GGTGATGCGC GTGAACACTG CGGCATAGCG ACAAGGCCAC CTGTCCGCCA
TGGCATTCAT GATTCATGGC CGTCCCTCCC CCTGCGAGAT TCCCCCACTC ACTTGCTCAC ACACCAAAGA AGCTACTGGG
GCAGGTGTGT CCATTGAATT GAATTGAATT GAAACTATTG ATGAATGAAT TCACCAGCCA GCTAGAACCT TCCTTGAAAC
CAGCCATAAA TCACACCCAT TCATCTCTCT CAACTCTCTG CAGCCCATTC ACTGCACCAG TGTAGTAGCA GTGCTGCAGT
TGCTTTGAAC ACTCATCTCC TCACCGTGTT TGTTAGAGCT CAAAAGGATC AAGAGAAGAT GAGGGTTCCT CCTCTTCGTG
CCACCACGGC TCTCCTGGCC ACCCTCCTGG TCGCCGCCTC GTTCCAGGAT CTCACCGTCG CTGCAGGTAA ACTTGCCATC
CAATTCACTC ACACACACAC ACTGATCTCC AGCGATCTTG GCAGGAGATG AGTACTAAAA TTGTTAACAT TTCGCGGATG
GATGCAGACG GCGGCGGCGG CGTGGTTCCG GTCCCGGATA GCGTGTGCGA CGCCAAGTGC CAGAAGCGGT GCTCGCTGAA
GGTGGCCGGG CGGTGCATGG GGCTGTGCAA GATGTGCTGC CACGACTGCG GCGGCTGCGT GCCGTCGGGG CCGTACGCCA
GCAAGGACGA GTGCCCCTGC TACCGCGACA TGGTCTCCCC CAAGAGCCGA CGGCCCAAGT GCCCGTGAGC AACGAGAGAT
GGCTGGCACT GTGACGATGT GTAGCCGATC CGTGGTAGTA GTGTGATTGA TAGCGTTGGG ATCGATCTCG GTTCTTTGAG
AAGTGTTAGT GCTTAGTGGA ATAAAACAAG AATGTCTGTC TAAGATATGT CTTGTGCTTT GTCCAGAGTA TGCTCTGATA
TCGCTCTGAT ATCTaggccg agtttagttc caaatttttt cttcaaactt tcaacttttt tatcacatca aaactttcct
acaacacaaa tttctaattt ttccattata tcgttccaat ttcaaccaaa tttccaattt tagcgtgaac taaacacacA
AGTTACTTTT GATTATTTTT TTTAAGCAAC AGAATTGAGA Atgagggtgt gtttagttca cgctaaaatt gaaagtttta
ttgagattgg aacgatgtaa cggaaaagtt agaagtttat gtatatagaa aattaaagtt ctgatgtgat ggaaaacttg
gaggtttaaa gaaaaagttg ggaactaaac cagacctGGA TCATCTGGCT CGAgcagggg cggagctagt atatattagg
ggggtgccca gaaacctggt caagaaaatt ttttagctat acctcatcta ttttcatcat gtatgtaccc tctaaataca
aacttaggca tccgcatcag cttaaacttg atctaaagta gagtaaatta aacaagtgac accaccatct atttc

Locus: Os07g0592000

Loading...

Locus: Os07g0592000

Loading...