Os07t0592600-01

Locus

Os07g0592600

Description

Indole-3-acetic acid (IAA)-amido synthetase, Auxin signaling and defense signaling in a pathogen-nonspecific manner

RAP-DB Gene Symbol Synonym(s)

GH3-8, OsGH3-8, OsMGH3, OsGH3.8

RAP-DB Gene Name Synonym(s)

GH3-8, IAA-amino synthetase, OsMADS1 regulated GH3 domain-encoding gene

CGSNL Gene Symbol

GH3-8

CGSNL Gene Name

GH3-8

Oryzabase Gene Symbol Synonym(s)

OsGH3-8, OsMGH3, OsGH3.8, GH3.8, OsGH3-2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK101193

Protein Evidence

Q0D4Z6

Literature

PMID: 15856348

PMID: 18192436

Note

Manual Curation

February 19, 2010

Functional domain (InterPro)

GH3 auxin-responsive promoter (IPR004993)

Full-length cDNA

J033030I03 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0592600-01)

RiceXPro (AK101193)

Others

Oryzabase (7349)

KEGG (Os07t0592600-01)

Transcript

2263 bp

>Os07t0592600-01 Indole-3-acetic acid (IAA)-amido synthetase, Auxin signaling and defense signaling in a pathogen-nonspecific manner
AGGCCACACACCACCAACACAAAACATTTCCTTGTCCCTCGCCTTCCTCGCCTCGCCTCG
GCTCTCACACGACGCCTCTTCCTCTCGCTACTACTAGCTCAAGCTAAGCTAGCAAGAGCA
TTCCTTGGGCTTTTTTTCTTGTTCGGGGTTGAGAGGCAATGGCGGTGATGACTGATGTGT
CGACCACCGGGACGGCACTCCGGACCCCGGCGGCGGGGGCGGTGAAGGAGGGCGACGTCG
AGAAGCTCCGGTTCATCGACGAGATGACCACCAACGTCGACGCCGTGCAGGAGCGCGTCC
TGGGGGAGATCCTCGGCCGCAACGCCGGCACGGAGTACCTGACCAAGTGCGGCCTCGACG
GCGCCACCGACCGCGCCGCCTTCCGGGCCAAGGTTCCGGTGGTGTCGTACGACGACCTGC
AGCCGTACATCCAGCGCATTGCGAACGGGGACCGCTCGCCGATCCTGTCCACCCACCCCG
TCTCCGAGTTCCTCACCAGCTCCGGCACGTCGGCCGGCGAGCGCAAGCTGATGCCCACCA
TCATGGACGAGCTCGACCGCCGTCAGCTGCTCTACAGCCTCCTCATGCCGGTCATGAACT
TGTATGTGCCTGGGCTTGACAAGGGGAAGGGGCTCTACTTCCTGTTCGTCAAGTCGGAGA
CGAAGACGCCGGGAGGCCTGACGGCGAGGCCCGTGCTGACGAGCTACTACAAGAGCGACC
ACTTCAAGAACCGGCCGTACGACCCGTACCACAACTACACGAGCCCGACGGCGGCCATCC
TCTGCGCCGACGCGTTCCAGAGCATGTACGCGCAGATGGTGTGCGGCCTGTGCCAGCGCA
ACGACGTGCTGCGCCTCGGCGCCGTGTTCGCCTCCGGCCTCCTCCGGGCCATCCGCTTCC
TCCAGCTCAACTGGGAGCAGCTCGCCGACGACATCGAGTCCGGCGAGCTCACCCCTCGCG
TCACCGACCCGTCGGTGCGCGAGGCTGTCGCCGCCATCCTCCTCCCGGACCCCGAGCTCG
CCAAGCTCATCCGCGCCGAGTGCTCCAAGGGCGACTGGGCCGGCATCATCACCCGCGTGT
GGCCGAACACCAAGTACCTCGACGTCATCGTCACCGGCGCGATGGCGCAGTACATCCCGA
CCCTGGAGTTCTACAGCGGCGGGCTTCCCATGGCGTGCACCATGTACGCGTCATCCGAGT
GCTACTTCGGCCTCAACCTCCGCCCCATGTGCGACCCCTCCGAGGTGTCCTACACCATCA
TGCCTAACATGGGCTACTTCGAGTTCCTCCCCGTGGACGAGACCGGCGCGGCTTCGGGCG
ACGCCACCCAGCTCGTGGACCTCGCCCGCGTGGAGGTGGGGCGCGAGTACGAGCTGGTGA
TCACCACCTACGCCGGGCTGAACCGGTACCGCGTCGGCGACGTCCTCCGCGTGACGGGGT
TCCACAACGCGGCGCCGCAGTTCAGGTTCGTGCGCCGCAAGAACGTGCTCCTCTCCATCG
AGTCCGACAAGACCGACGAGGCCGAGCTGCAGCGCGCCGTGGAGCGCGCGTCGGCGCTGC
TCCGCCCGCACGGCGCGTCCGTGGTGGAGTACACCAGCCAAGCGTGCACCAAGCGCATCC
CGGGCCACTACGTCATCTACTGGGAGCTCCTGACCAAGGGCGCCGGCGCCACGGTGGTGG
ACGCGGACACGCTGGGCAGGTGCTGCCTCGAGATGGAGGAGGCGCTGAACACGGTGTACA
GGCAGAGCCGCGTCGCGGACGGCTCGATTGGGCCGCTCGAGATCCGGGTCGTCCGCCCGG
GCACATTCGAGGAGCTCATGGACTACGCCATCTCCCGCGGCGCGTCCATCAACCAGTACA
AGGTGCCACGCTGCGTCACGTTCCCGCCCATCGTCGAGCTGCTCGACTCGCGCGTCGTGT
CCAGCCACTTCAGCCCGGCGCTCCCACACTGGACTCCGGCGCGACGGTCCGAATAGTCGG
TCAAATCCCCACCTCGTCGTTGGACCGTGTCCAAGAATCTGAAGTAGTAGAAGCCGGATG
CCTCCACCTAAAAACACTTATCTGTTATTTTTGGAATTAATTTTGATGGTTGCTGTCAAC
TCTGTCAGTTAGTGGCAAGAGGGTACCTCTGATGTGAGGGAGAGAACTGCAGAACGAACG
GAAGAAAGTGTTGATGTAAGAGGTTACCACTAGTAGTACTGTTTGTCTGTATCAGGAATG
TGATTATAATTTAACCTGTCCTCCAAAACCGTACGAGTCCTGC

CDS

1818 bp

>Os07t0592600-01 Indole-3-acetic acid (IAA)-amido synthetase, Auxin signaling and defense signaling in a pathogen-nonspecific manner
ATGGCGGTGATGACTGATGTGTCGACCACCGGGACGGCACTCCGGACCCCGGCGGCGGGG
GCGGTGAAGGAGGGCGACGTCGAGAAGCTCCGGTTCATCGACGAGATGACCACCAACGTC
GACGCCGTGCAGGAGCGCGTCCTGGGGGAGATCCTCGGCCGCAACGCCGGCACGGAGTAC
CTGACCAAGTGCGGCCTCGACGGCGCCACCGACCGCGCCGCCTTCCGGGCCAAGGTTCCG
GTGGTGTCGTACGACGACCTGCAGCCGTACATCCAGCGCATTGCGAACGGGGACCGCTCG
CCGATCCTGTCCACCCACCCCGTCTCCGAGTTCCTCACCAGCTCCGGCACGTCGGCCGGC
GAGCGCAAGCTGATGCCCACCATCATGGACGAGCTCGACCGCCGTCAGCTGCTCTACAGC
CTCCTCATGCCGGTCATGAACTTGTATGTGCCTGGGCTTGACAAGGGGAAGGGGCTCTAC
TTCCTGTTCGTCAAGTCGGAGACGAAGACGCCGGGAGGCCTGACGGCGAGGCCCGTGCTG
ACGAGCTACTACAAGAGCGACCACTTCAAGAACCGGCCGTACGACCCGTACCACAACTAC
ACGAGCCCGACGGCGGCCATCCTCTGCGCCGACGCGTTCCAGAGCATGTACGCGCAGATG
GTGTGCGGCCTGTGCCAGCGCAACGACGTGCTGCGCCTCGGCGCCGTGTTCGCCTCCGGC
CTCCTCCGGGCCATCCGCTTCCTCCAGCTCAACTGGGAGCAGCTCGCCGACGACATCGAG
TCCGGCGAGCTCACCCCTCGCGTCACCGACCCGTCGGTGCGCGAGGCTGTCGCCGCCATC
CTCCTCCCGGACCCCGAGCTCGCCAAGCTCATCCGCGCCGAGTGCTCCAAGGGCGACTGG
GCCGGCATCATCACCCGCGTGTGGCCGAACACCAAGTACCTCGACGTCATCGTCACCGGC
GCGATGGCGCAGTACATCCCGACCCTGGAGTTCTACAGCGGCGGGCTTCCCATGGCGTGC
ACCATGTACGCGTCATCCGAGTGCTACTTCGGCCTCAACCTCCGCCCCATGTGCGACCCC
TCCGAGGTGTCCTACACCATCATGCCTAACATGGGCTACTTCGAGTTCCTCCCCGTGGAC
GAGACCGGCGCGGCTTCGGGCGACGCCACCCAGCTCGTGGACCTCGCCCGCGTGGAGGTG
GGGCGCGAGTACGAGCTGGTGATCACCACCTACGCCGGGCTGAACCGGTACCGCGTCGGC
GACGTCCTCCGCGTGACGGGGTTCCACAACGCGGCGCCGCAGTTCAGGTTCGTGCGCCGC
AAGAACGTGCTCCTCTCCATCGAGTCCGACAAGACCGACGAGGCCGAGCTGCAGCGCGCC
GTGGAGCGCGCGTCGGCGCTGCTCCGCCCGCACGGCGCGTCCGTGGTGGAGTACACCAGC
CAAGCGTGCACCAAGCGCATCCCGGGCCACTACGTCATCTACTGGGAGCTCCTGACCAAG
GGCGCCGGCGCCACGGTGGTGGACGCGGACACGCTGGGCAGGTGCTGCCTCGAGATGGAG
GAGGCGCTGAACACGGTGTACAGGCAGAGCCGCGTCGCGGACGGCTCGATTGGGCCGCTC
GAGATCCGGGTCGTCCGCCCGGGCACATTCGAGGAGCTCATGGACTACGCCATCTCCCGC
GGCGCGTCCATCAACCAGTACAAGGTGCCACGCTGCGTCACGTTCCCGCCCATCGTCGAG
CTGCTCGACTCGCGCGTCGTGTCCAGCCACTTCAGCCCGGCGCTCCCACACTGGACTCCG
GCGCGACGGTCCGAATAG

Protein

606 aa

>Os07t0592600-01 Indole-3-acetic acid (IAA)-amido synthetase, Auxin signaling and defense signaling in a pathogen-nonspecific manner
MAVMTDVSTTGTALRTPAAGAVKEGDVEKLRFIDEMTTNVDAVQERVLGEILGRNAGTEY
LTKCGLDGATDRAAFRAKVPVVSYDDLQPYIQRIANGDRSPILSTHPVSEFLTSSGTSAG
ERKLMPTIMDELDRRQLLYSLLMPVMNLYVPGLDKGKGLYFLFVKSETKTPGGLTARPVL
TSYYKSDHFKNRPYDPYHNYTSPTAAILCADAFQSMYAQMVCGLCQRNDVLRLGAVFASG
LLRAIRFLQLNWEQLADDIESGELTPRVTDPSVREAVAAILLPDPELAKLIRAECSKGDW
AGIITRVWPNTKYLDVIVTGAMAQYIPTLEFYSGGLPMACTMYASSECYFGLNLRPMCDP
SEVSYTIMPNMGYFEFLPVDETGAASGDATQLVDLARVEVGREYELVITTYAGLNRYRVG
DVLRVTGFHNAAPQFRFVRRKNVLLSIESDKTDEAELQRAVERASALLRPHGASVVEYTS
QACTKRIPGHYVIYWELLTKGAGATVVDADTLGRCCLEMEEALNTVYRQSRVADGSIGPL
EIRVVRPGTFEELMDYAISRGASINQYKVPRCVTFPPIVELLDSRVVSSHFSPALPHWTP
ARRSE*

5'UTR

chr07:24151917..24152074 (- strand) : 158 bp

CDS

chr07:24151474..24151916 (- strand) : 443 bp

chr07:24150005..24151379 (- strand) : 1375 bp

3'UTR

chr07:24149718..24150004 (- strand) : 287 bp

FASTA

>Os07t0592600-01 class=Sequence position=chr07:24149718..24152074 (- strand)
AGGCCACACA CCACCAACAC AAAACATTTC CTTGTCCCTC GCCTTCCTCG CCTCGCCTCG GCTCTCACAC GACGCCTCTT
CCTCTCGCTA CTACTAGCTC AAGCTAAGCT AGCAAGAGCA TTCCTTGGGC TTTTTTTCTT GTTCGGGGTT GAGAGGCAAT
GGCGGTGATG ACTGATGTGT CGACCACCGG GACGGCACTC CGGACCCCGG CGGCGGGGGC GGTGAAGGAG GGCGACGTCG
AGAAGCTCCG GTTCATCGAC GAGATGACCA CCAACGTCGA CGCCGTGCAG GAGCGCGTCC TGGGGGAGAT CCTCGGCCGC
AACGCCGGCA CGGAGTACCT GACCAAGTGC GGCCTCGACG GCGCCACCGA CCGCGCCGCC TTCCGGGCCA AGGTTCCGGT
GGTGTCGTAC GACGACCTGC AGCCGTACAT CCAGCGCATT GCGAACGGGG ACCGCTCGCC GATCCTGTCC ACCCACCCCG
TCTCCGAGTT CCTCACCAGC TCCGGCACGT CGGCCGGCGA GCGCAAGCTG ATGCCCACCA TCATGGACGA GCTCGACCGC
CGTCAGCTGC TCTACAGCCT CCTCATGCCG GTCATGAACT TGTAAGTTGA TACTACTCCT ATCATTGTCT CATTCTGATA
GCACACACAC GTACAAGAAG CAGATGATGA TTAATGGCCA TGAATCATTG CATAGGTATG TGCCTGGGCT TGACAAGGGG
AAGGGGCTCT ACTTCCTGTT CGTCAAGTCG GAGACGAAGA CGCCGGGAGG CCTGACGGCG AGGCCCGTGC TGACGAGCTA
CTACAAGAGC GACCACTTCA AGAACCGGCC GTACGACCCG TACCACAACT ACACGAGCCC GACGGCGGCC ATCCTCTGCG
CCGACGCGTT CCAGAGCATG TACGCGCAGA TGGTGTGCGG CCTGTGCCAG CGCAACGACG TGCTGCGCCT CGGCGCCGTG
TTCGCCTCCG GCCTCCTCCG GGCCATCCGC TTCCTCCAGC TCAACTGGGA GCAGCTCGCC GACGACATCG AGTCCGGCGA
GCTCACCCCT CGCGTCACCG ACCCGTCGGT GCGCGAGGCT GTCGCCGCCA TCCTCCTCCC GGACCCCGAG CTCGCCAAGC
TCATCCGCGC CGAGTGCTCC AAGGGCGACT GGGCCGGCAT CATCACCCGC GTGTGGCCGA ACACCAAGTA CCTCGACGTC
ATCGTCACCG GCGCGATGGC GCAGTACATC CCGACCCTGG AGTTCTACAG CGGCGGGCTT CCCATGGCGT GCACCATGTA
CGCGTCATCC GAGTGCTACT TCGGCCTCAA CCTCCGCCCC ATGTGCGACC CCTCCGAGGT GTCCTACACC ATCATGCCTA
ACATGGGCTA CTTCGAGTTC CTCCCCGTGG ACGAGACCGG CGCGGCTTCG GGCGACGCCA CCCAGCTCGT GGACCTCGCC
CGCGTGGAGG TGGGGCGCGA GTACGAGCTG GTGATCACCA CCTACGCCGG GCTGAACCGG TACCGCGTCG GCGACGTCCT
CCGCGTGACG GGGTTCCACA ACGCGGCGCC GCAGTTCAGG TTCGTGCGCC GCAAGAACGT GCTCCTCTCC ATCGAGTCCG
ACAAGACCGA CGAGGCCGAG CTGCAGCGCG CCGTGGAGCG CGCGTCGGCG CTGCTCCGCC CGCACGGCGC GTCCGTGGTG
GAGTACACCA GCCAAGCGTG CACCAAGCGC ATCCCGGGCC ACTACGTCAT CTACTGGGAG CTCCTGACCA AGGGCGCCGG
CGCCACGGTG GTGGACGCGG ACACGCTGGG CAGGTGCTGC CTCGAGATGG AGGAGGCGCT GAACACGGTG TACAGGCAGA
GCCGCGTCGC GGACGGCTCG ATTGGGCCGC TCGAGATCCG GGTCGTCCGC CCGGGCACAT TCGAGGAGCT CATGGACTAC
GCCATCTCCC GCGGCGCGTC CATCAACCAG TACAAGGTGC CACGCTGCGT CACGTTCCCG CCCATCGTCG AGCTGCTCGA
CTCGCGCGTC GTGTCCAGCC ACTTCAGCCC GGCGCTCCCA CACTGGACTC CGGCGCGACG GTCCGAATAG TCGGTCAAAT
CCCCACCTCG TCGTTGGACC GTGTCCAAGA ATCTGAAGTA GTAGAAGCCG GATGCCTCCA CCTAAAAACA CTTATCTGTT
ATTTTTGGAA TTAATTTTGA TGGTTGCTGT CAACTCTGTC AGTTAGTGGC AAGAGGGTAC CTCTGATGTG AGGGAGAGAA
CTGCAGAACG AACGGAAGAA AGTGTTGATG TAAGAGGTTA CCACTAGTAG TACTGTTTGT CTGTATCAGG AATGTGATTA
TAATTTAACC TGTCCTCCAA AACCGTACGA GTCCTGC