Os07t0605200-01

Locus

Os07g0605200

Description

APETALA1 (AP1)/ FRUITFULL (FUL)-like MADS box transcription factor, Specification of inflorescence meristem identity

RAP-DB Gene Symbol Synonym(s)

MADS18, OsMADS18, MADS2, OsMADS2, MADS28, OsMADS28, FDRMADS7, OsMADS18/28

RAP-DB Gene Name Synonym(s)

MADS BOX GENE 18, MADS box gene18, MADS-box transcription factor 18, MADS-box protein 2, MADS-box protein 28

CGSNL Gene Symbol

MADS18

CGSNL Gene Name

MADS BOX GENE 18

Oryzabase Gene Symbol Synonym(s)

OsMADS18, MADS2, OsMADS2, MADS28, OsMADS28, FDRMADS7, OsMADS18/28

Oryzabase Gene Name Synonym(s)

MADS box gene18, MADS-box transcription factor 18, MADS-box protein 2, MADS-box protein 28

Transcript Evidence

AK064704

Protein Evidence

Q0D4T4

Literature

PMID: 22570445

PMID: 10444103

Note

Manual Curation

September 9, 2014

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein dimerization activity (GO:0046983)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor, MADS-box (IPR002100)

Transcription factor, K-box (IPR002487)

Full-length cDNA

002-118-A02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0605200-01)

Others

Oryzabase (3086)

KEGG (Os07t0605200-01)

Transcript

1088 bp

>Os07t0605200-01 APETALA1 (AP1)/ FRUITFULL (FUL)-like MADS box transcription factor, Specification of inflorescence meristem identity
CTCCCCCCATTTCCATCTTCCCCGAGCTCTCCACCCTCCACCCGCCACCGCCACCGCCGC
CTTCGCCGCCGCCGCCGCCGCCGACGACGATGGGGAGAGGGCCGGTGCAGCTGCGGCGGA
TCGAGAACAAGATAAACAGGCAGGTGACCTTCTCCAAGCGGAGGAACGGGCTGCTGAAGA
AGGCGCACGAGATCTCCGTGCTCTGTGACGCCGACGTCGCGCTCATCGTCTTCTCCACCA
AGGGCAAGCTCTACGAGTTCTCCAGCCACTCCAGTATGGAAGGGATCCTTGAACGCTACC
AGCGTTACTCGTTTGATGAAAGAGCCGTACTGGAGCCAAATACTGAGGACCAGGAAAACT
GGGGTGATGAATATGGAATTTTGAAGTCCAAACTGGATGCACTTCAGAAGAGCCAAAGGC
AACTCTTAGGTGAACAATTGGACACACTAACAATAAAAGAACTCCAGCAATTGGAACATC
AACTGGAATATTCTCTGAAGCATATAAGATCAAAAAAGAATCAGCTTCTGTTTGAATCAA
TTTCTGAGCTTCAGAAGAAGGAAAAGTCACTTAAAAACCAGAATAATGTTCTGCAAAAGC
TCATGGAGACAGAAAAGGAGAAAAACAATGCTATAATAAACACTAACCGGGAGGAGCAAA
ATGGAGCAACACCAAGCACATCATCACCAACACCAGTGACGGCTCCAGATCCCATCCCGA
CAACAAATAACAGTCAAAGCCAACCAAGAGGATCAGGGGAGTCAGAAGCTCAACCGTCTC
CGGCACAAGCAGGCAACAGCAAGCTTCCGCCATGGATGCTCCGGACAAGTCACACATGAA
GGCATCTGTTGATCTCAAACGTCACTCCACTCAATGGCCAACATCAACATGTTTCTTCCA
ACTAAGGCAGCCACTGTTGTGCAATCCATCTTCCAGCGATATTGATATATCGGCATTCGG
CATAGCCAATATATATTAATGTAATGTATCTTGTCAAAGCTTCATAGGGTTAATGACGCC
TTGAGCTTCTCTGTTCTATATCTGTCTTGTAACGATCTTTGCATATCTGCTGCATTTTTT
TTTCTCTC

CDS

750 bp

>Os07t0605200-01 APETALA1 (AP1)/ FRUITFULL (FUL)-like MADS box transcription factor, Specification of inflorescence meristem identity
ATGGGGAGAGGGCCGGTGCAGCTGCGGCGGATCGAGAACAAGATAAACAGGCAGGTGACC
TTCTCCAAGCGGAGGAACGGGCTGCTGAAGAAGGCGCACGAGATCTCCGTGCTCTGTGAC
GCCGACGTCGCGCTCATCGTCTTCTCCACCAAGGGCAAGCTCTACGAGTTCTCCAGCCAC
TCCAGTATGGAAGGGATCCTTGAACGCTACCAGCGTTACTCGTTTGATGAAAGAGCCGTA
CTGGAGCCAAATACTGAGGACCAGGAAAACTGGGGTGATGAATATGGAATTTTGAAGTCC
AAACTGGATGCACTTCAGAAGAGCCAAAGGCAACTCTTAGGTGAACAATTGGACACACTA
ACAATAAAAGAACTCCAGCAATTGGAACATCAACTGGAATATTCTCTGAAGCATATAAGA
TCAAAAAAGAATCAGCTTCTGTTTGAATCAATTTCTGAGCTTCAGAAGAAGGAAAAGTCA
CTTAAAAACCAGAATAATGTTCTGCAAAAGCTCATGGAGACAGAAAAGGAGAAAAACAAT
GCTATAATAAACACTAACCGGGAGGAGCAAAATGGAGCAACACCAAGCACATCATCACCA
ACACCAGTGACGGCTCCAGATCCCATCCCGACAACAAATAACAGTCAAAGCCAACCAAGA
GGATCAGGGGAGTCAGAAGCTCAACCGTCTCCGGCACAAGCAGGCAACAGCAAGCTTCCG
CCATGGATGCTCCGGACAAGTCACACATGA

Protein

249 aa

>Os07t0605200-01 APETALA1 (AP1)/ FRUITFULL (FUL)-like MADS box transcription factor, Specification of inflorescence meristem identity
MGRGPVQLRRIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSSH
SSMEGILERYQRYSFDERAVLEPNTEDQENWGDEYGILKSKLDALQKSQRQLLGEQLDTL
TIKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLMETEKEKNN
AIINTNREEQNGATPSTSSPTPVTAPDPIPTTNNSQSQPRGSGESEAQPSPAQAGNSKLP
PWMLRTSHT*

5'UTR

chr07:24788476..24788564 (+ strand) : 89 bp

CDS

chr07:24788565..24788749 (+ strand) : 185 bp

chr07:24791477..24791555 (+ strand) : 79 bp

chr07:24791650..24791714 (+ strand) : 65 bp

chr07:24791794..24791893 (+ strand) : 100 bp

chr07:24792009..24792050 (+ strand) : 42 bp

chr07:24792642..24792680 (+ strand) : 39 bp

chr07:24792777..24792910 (+ strand) : 134 bp

chr07:24793325..24793430 (+ strand) : 106 bp

3'UTR

chr07:24793431..24793679 (+ strand) : 249 bp

FASTA

>Os07t0605200-01 class=Sequence position=chr07:24788476..24793679 (+ strand)
CTCCCCCCAT TTCCATCTTC CCCGAGCTCT CCACCCTCCA CCCGCCACCG CCACCGCCGC CTTCGCCGCC GCCGCCGCCG
CCGACGACGA TGGGGAGAGG GCCGGTGCAG CTGCGGCGGA TCGAGAACAA GATAAACAGG CAGGTGACCT TCTCCAAGCG
GAGGAACGGG CTGCTGAAGA AGGCGCACGA GATCTCCGTG CTCTGTGACG CCGACGTCGC GCTCATCGTC TTCTCCACCA
AGGGCAAGCT CTACGAGTTC TCCAGCCACT CCAGGTACGC ACGCGCTTAG CTCCTCCTCC TCCTCCTCCT CCTCTCCGCG
ACCTCCCGCC TACCTACGTA GTACGGCCCA TGCCCGTCGC CTTTCCTCGC CGCGCGCGCG CCATGGGCGA GCTCGCGGAG
CTCCCCGTTC CTGGGCGGCT TGTTGATGCG TTCGATTTCG TTTCGTACGG GTTCCTGCCT TGTGTTCGAT CGTTTCCGCT
GCGGAATGCG AGGGGGCTGG TGGTGTTGGT GCGTGTACGA TTGCTATTAT TTCGTGCTGA TTGATTTCTC TCATGTGCTC
TCTGATTGCA CATACGGTTC ATGGCTTTGT ACGTGTTCGT TCGTGCGATT GCTGCTTAGC TCGGGATGGA GTTGCTCGCG
AAGTCTAGCT AGTTGTAGGT TGCTTGTGTC CCCTGGATTA CAGCTCTCTA TGTGATGCTG GCATGCTGCT GCTGCTGCTG
CCATGCATAT CAGAAGCTAG TAATATACAG TGGTGGTACA TGCACTGTTG CTGATTTAGC TTTATATGCT GCTCAGTTTT
GTTCTTGGGG ACTCATCAAT CATCGTAGCA TTGGTGAACA CGTTCACTTC CATTTTTTTT TGTATAAAAA GGAATGGAAT
AATAGGTGAA AAAAAATTCA TGTGCTTCAT CAGTACGGGC GGAAAGAAAG ATATGTTTAA ATTTTAATTA GTGTGCTTAT
CTAGGTTTAT CATATGCTTA TACTCTTGTG TACTGTAGCA TATACAAGTG ATGCTTATTA CCAAAGCCTA GCTAGGCCGG
TAAACTTGTA TTATTTGTCT CGTTATTTCT GGAAATCATT AGAGCAGCAC TTCAGTTGAA ATATGCACGG ACGCCTTGCT
AATTAAGCGG CTCCTCTAAC CAGGCCAGTA AGGTCTTAAG TTACTGACAA CTCCTGGACT GGTATAAATG GCGCGGCCAG
CTTTACATGA CATATGGTTT GATACTTTTG TTTAGTTAAT TTCGAGGTGG AATATAAGGT GACCAGCTTA CTTAACTTGT
TCATTTGATG CATTCGGTTT CATTTCCCTT TTTTTTTTTA AGATAATGGG AAGTAAATTA ATACCCGGCC TTGCTTTAAC
TGAAACTACA ACTTTCTTTT GTCCCTTTAG TGTGTACTGT CACCAAGTTA GCTATACATG GTGCAAGTTG CCATTGCCCA
TTGCTATTAA CTTGCTCTCA CAAATTGGGG TGTTTATTTC TTGAAATGGA TTTTTTAGGA CAACAATAAA CTGATTGACA
TAGCTATACT GTTCAAGTAT AACCATGTTT ATGGTTTTCA ATTAAGCAAA CTGCTTATGT TTATGCTAAT ATCTTTTGTT
TAATGGGAGG AATTTAAATA TTTCATTATT GGTATTCCTA TACTCTATTA Tttcataata tttggcaatt ttgaccggtg
attgcttcag tttaaccatt aatatctttt aaaatttatg attatgatgg atgggattta tatctctata tttaccatta
ccatgtaaca tactttaata atatgttaca taatctaata ctaaaagttt atttataaaa ttggaatggc caaactaaaa
caatgcgaac ttaaaatcac caagtattat gaaatggagg gagcataATA TCAGTAGCTC GTAAGGGAAA AAAGGGACCT
AAATGATGCC TTTTGTGATA AATATAATTT CAAATTTGCA AAATTTTTGG ATAGGCAACA ATACTCTCTC ATTATTGTGT
TAGTATTAAG GTCAAGCTAC TTCTATGCTA CCAAATACTC CTTCTGTTCC TTTTTTTATT TCTTGTCTAG GATATTGACA
TTATCCCTAA CACACATCTT TCTTTGTATG ATCATCTACT CATAAAATAG TTAAAATATA ACTACATTAT TCAATTATGA
ATCTATGAAT GTTATTTTTA TACACCGAGT Tgggaactat tctaaactct cgaggggaca tcccctcatt atctgcatgt
tatccaaacg gttgtgaaaa aaattgaaaa aaaataaaca agatagatta atatgtgata aatcactcca caaacatgca
aggacaaatt caaattctac aagttgcaat gaaaaaatta aatttgaccg tgaatataca ttaactagcc atagtttaat
ttttttttgt tgtaacttgt agaagttgaa tttgaacttg catgtttgtg aagtaatcta tcacatatta atctatcttg
tcgatttttt tttaaaaaaa tcataaccat ttagatgaca tgcaaaaaac gaggggatgt tcccttgaga gtttagaatc
cattcTCCAG TGAGTTGATG TTGAGATTTG ATTACACATT TCAAAACGAC TTTTATTTGT TAACGAAGGG AGTAATGTGG
ATTCACCATA TGTACTAATG TTATTAAGGC CAGATAATCC TTTTTTTAAT CATTCTAATT AGATATAAAC TTACGACGAA
GAACATGAAT GGATAAAGTT TCAGCCAACA AATACAAATG TTTTTCAAAG TGCTATTTCT GATGCATAAT TTTTGTAGCA
GTTATGATTT AAATTTATAC ATGGATAATT TGAATAATGG ATCCTACTTT TGTAGTTGTC ACCTGACAAG CCTTAAGAAT
TATTGAGGGT ACAAAAATTA TAACTGTGCA TTTGTTTGAT ATTGCTCTAA GACTATGCTT GGCATCATCT TTTGATGCAT
TGGTCAAACC AAAGCATAAT CATGTGATAC TTCTTCTGTA GTATGGAAGG GATCCTTGAA CGCTACCAGC GTTACTCGTT
TGATGAAAGA GCCGTACTGG AGCCAAATAC TGAGGACCAG GTAAAAAAAC ATCCCTGACT GTTGGAGAAC TATCTCCGGC
TGTTTATTTA ACTAGCTGGT TAGTTATCTG ATCTTGATAT TCATTTTCTC CTAGGAAAAC TGGGGTGATG AATATGGAAT
TTTGAAGTCC AAACTGGATG CACTTCAGAA GAGCCAAAGG TACTGCAAAC TTTCTTAAGA AATTTTCACT TTGGTAACAA
GATTATGCTA ACTTGAGTTG GTCTATCTAC TGCTCAAGGC AACTCTTAGG TGAACAATTG GACACACTAA CAATAAAAGA
ACTCCAGCAA TTGGAACATC AACTGGAATA TTCTCTGAAG CATATAAGAT CAAAAAAGGT GAAATTTGTG TCCATTATGC
ACTGTTGACT GAGGGATCAA ATTTGCTTGA TTTAATTATT TCCAACTAAT CTTTGAAAAC ATCATTACTT TCCTTTTTGT
TTTTCTTTTG CAGAATCAGC TTCTGTTTGA ATCAATTTCT GAGCTTCAGA AGAAGGTAGG TTACCCTCAA TGTGGCTCCT
TAAATAGCAA TGTAGCAGTC TGTTTATACC ATATTGTTTT GGAGTATTAA AGTTGCATTC AAACAATTTT CAGACAACTA
ACTCTTCTTG CCTTCTACCA GAATATATTC ATGTAAAACA TGTCTTTTGG CAATTCTAGA AATTCCATTA TAAGAAGAAA
TCATTAGTCA ATTTGAATCA CCTAAGGAAC TAACGAGAAG CCACTTGTCT TGGTCATATT GTGGGAAATG CACAATGTTG
TCAAATGGGT ATAACAGGAA AGTCGCCATC AATGTATATA TTCTAGGGGA GAGAGAACAG ACTAAGTCAG ACTACGTTGT
AAAATTGAAC ATTCTACGGG AAAATAAATC TTCGATGCAT ATGGCAAGGA CTTGACCGTT AGCCTTTTAC GCAATAATGT
ATGCATAAAC ATAGGGAAAA AAAAGGACCT GCACTACTGA TTGTTACTGT ATCTGATCTG GCAAGTGGCA ACAGAGCCAT
GTTAATATTG TGCTGAGAAA TGGACGAAGT TGATATAGGT TCGTGCTGAT GAATATTCTT ACAATCTGCT ATCTTCCTGT
CTGCAGGAAA AGTCACTTAA AAACCAGAAT AATGTTCTGC AAAAGGTAAA TTTCATTCTT GTTTACAACA ATGTTTTATA
TCAGATCACT ACAAAAGCTG TATTGGAGGT CAAACCCTTT TGTCTACATT CTTCGGAGCA GCTCATGGAG ACAGAAAAGG
AGAAAAACAA TGCTATAATA AACACTAACC GGGAGGAGCA AAATGGAGCA ACACCAAGCA CATCATCACC AACACCAGTG
ACGGCTCCAG ATCCCATCCC GACAACAAAT AACAGGTACC GCTTTTACTT CCATATATTT TGCCCCTGCA CTCACCATAA
ATAAAACAAA ACTCTGTTTT GTTCTTCAGC AAATTTTTAT TCTATATTTT TTCTTTTATC AGACTTCCAT TATCTATCAC
AGTTCAGTAG TTTTTGATGG TCTATGCCTA GGAAACTTAA TCCGGTGAAA TTTGTTCAAT CAAATGCTGC CGGTCTATTT
CATATGGCTA TTGGAAGTTT GGAACAAATA AGCCCAGGCC TGAAAGCGCC TGAACCAAAC AGTGAAAAAG CCTCCAAATG
GTTTGGTCTC AGCTTGATAT ATCATGTCTG AACAATAACT TGACGTTAGG AATGATCTAG CATGTTACTA CTATTTCATC
AACTCCATTG TCTGTTTTAG TTATGCTGTT TTTCCTCATC TTAATTCAGT CAAAGCCAAC CAAGAGGATC AGGGGAGTCA
GAAGCTCAAC CGTCTCCGGC ACAAGCAGGC AACAGCAAGC TTCCGCCATG GATGCTCCGG ACAAGTCACA CATGAAGGCA
TCTGTTGATC TCAAACGTCA CTCCACTCAA TGGCCAACAT CAACATGTTT CTTCCAACTA AGGCAGCCAC TGTTGTGCAA
TCCATCTTCC AGCGATATTG ATATATCGGC ATTCGGCATA GCCAATATAT ATTAATGTAA TGTATCTTGT CAAAGCTTCA
TAGGGTTAAT GACGCCTTGA GCTTCTCTGT TCTATATCTG TCTTGTAACG ATCTTTGCAT ATCTGCTGCA TTTTTTTTTC
TCTC

Locus: Os07g0605200

Loading...

Locus: Os07g0605200

Loading...