Os07t0606600-01

Locus

Os07g0606600

Description

Similar to Nuclear factor Y transcription factor subunit B homolog.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP3F

CGSNL Gene Name

HAP3F SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3F, NF-YB, CBF-A, NF-YB10, OsNF-YB10, NFYB10

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit B10, NUCLEAR FACTOR-Y subunit NF-YB10, NF-YB subunit 10, NF-YB family 10

Transcript Evidence

AK112118 (DDBJ, Best hit)

AK111621 (DDBJ, Best hit)

Protein Evidence

NP_001147727.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Transcription factor, CBFA/NFYB, DNA topoisomerase (IPR003957)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

002-139-C11 (Online Clone Ordering)

J013109P12 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0606600-01)

RiceXPro (AK112118)

Others

Oryzabase (8485)

KEGG (Os07t0606600-01)

Transcript

932 bp

>Os07t0606600-01 Similar to Nuclear factor Y transcription factor subunit B homolog.
CCCGCGCCCTCCTCTCCTCTTCGTCTTCCTCCTCGCTTCGCTTCGACTGCTTCGATCGAG
GAGATCGAGGTTGCGATGCCGGATTCGGACAACGAGTCAGGGGGGCCGAGCAACGCGGGG
GAGTACGCGTCGGCGAGGGAGCAGGACAGGTTCCTGCCGATCGCGAACGTGAGCAGGATC
ATGAAGAGGGCGCTCCCGGCGAACGCCAAGATCAGCAAGGACGCCAAGGAGACGGTGCAG
GAGTGCGTCTCGGAGTTCATCTCCTTCATCACCGGCGAGGCCTCCGACAAGTGCCAGCGG
GAGAAGCGCAAGACCATCAACGGCGACGACCTCCTCTGGGCGATGACCACGCTCGGCTTC
GAGGACTACATCGACCCGCTCAAGCTCTACCTCCACAAGTTCCGCGAGCTCGAGGGCGAG
AAGGCCATCGGCGCCGCCGGCAGCGGCGGCGGTGGCGCCGCCTCCTCCGGCGGCTCCGGC
TCCGGCTCCGGCTCGCACCACCACCAGGATGCTTCCCGGAACAATGGCGGATACGGCATG
TACGGCGGCGGCGGCGGCATGATCATGATGATGGGACAGCCTATGTACGGCTCGCCGCCG
GCGTCGTCAGCTGGGTACGCGCAGCCGCCGCCGCCCCACCACCACCACCACCAGATGGTG
ATGGGAGGGAAAGGTGCGTATGGCCATGGCGGCGGCGGCGGCGGCGGGCCCTCCCCGTCG
TCGGGATACGGCCGGCAAGACAGGCTATGAGCTTGCTTTCTTGGTTGGTGTTTTGGTAAT
TAATTAATCAGAGGACATGTCGGGTTAATTAATCTTAATCTCTGTTTTTTCACTCTTTTT
TTTTACCTTTCTTTCTCTCTCTTTTATCTTTCCTTTTCTCAATGTGCTAAAATGAGTCAA
TTATATGGCTAAATTCTCTACTAATTCGCTTC

CDS

675 bp

>Os07t0606600-01 Similar to Nuclear factor Y transcription factor subunit B homolog.
ATGCCGGATTCGGACAACGAGTCAGGGGGGCCGAGCAACGCGGGGGAGTACGCGTCGGCG
AGGGAGCAGGACAGGTTCCTGCCGATCGCGAACGTGAGCAGGATCATGAAGAGGGCGCTC
CCGGCGAACGCCAAGATCAGCAAGGACGCCAAGGAGACGGTGCAGGAGTGCGTCTCGGAG
TTCATCTCCTTCATCACCGGCGAGGCCTCCGACAAGTGCCAGCGGGAGAAGCGCAAGACC
ATCAACGGCGACGACCTCCTCTGGGCGATGACCACGCTCGGCTTCGAGGACTACATCGAC
CCGCTCAAGCTCTACCTCCACAAGTTCCGCGAGCTCGAGGGCGAGAAGGCCATCGGCGCC
GCCGGCAGCGGCGGCGGTGGCGCCGCCTCCTCCGGCGGCTCCGGCTCCGGCTCCGGCTCG
CACCACCACCAGGATGCTTCCCGGAACAATGGCGGATACGGCATGTACGGCGGCGGCGGC
GGCATGATCATGATGATGGGACAGCCTATGTACGGCTCGCCGCCGGCGTCGTCAGCTGGG
TACGCGCAGCCGCCGCCGCCCCACCACCACCACCACCAGATGGTGATGGGAGGGAAAGGT
GCGTATGGCCATGGCGGCGGCGGCGGCGGCGGGCCCTCCCCGTCGTCGGGATACGGCCGG
CAAGACAGGCTATGA

Protein

225 aa

>Os07t0606600-01 Similar to Nuclear factor Y transcription factor subunit B homolog.
MPDSDNESGGPSNAGEYASAREQDRFLPIANVSRIMKRALPANAKISKDAKETVQECVSE
FISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYIDPLKLYLHKFRELEGEKAIGA
AGSGGGGAASSGGSGSGSGSHHHQDASRNNGGYGMYGGGGGMIMMMGQPMYGSPPASSAG
YAQPPPPHHHHHQMVMGGKGAYGHGGGGGGGPSPSSGYGRQDRL*

5'UTR

chr07:24921924..24921998 (- strand) : 75 bp

CDS

chr07:24921249..24921923 (- strand) : 675 bp

3'UTR

chr07:24921067..24921248 (- strand) : 182 bp

FASTA

>Os07t0606600-01 class=Sequence position=chr07:24921067..24921998 (- strand)
CCCGCGCCCT CCTCTCCTCT TCGTCTTCCT CCTCGCTTCG CTTCGACTGC TTCGATCGAG GAGATCGAGG TTGCGATGCC
GGATTCGGAC AACGAGTCAG GGGGGCCGAG CAACGCGGGG GAGTACGCGT CGGCGAGGGA GCAGGACAGG TTCCTGCCGA
TCGCGAACGT GAGCAGGATC ATGAAGAGGG CGCTCCCGGC GAACGCCAAG ATCAGCAAGG ACGCCAAGGA GACGGTGCAG
GAGTGCGTCT CGGAGTTCAT CTCCTTCATC ACCGGCGAGG CCTCCGACAA GTGCCAGCGG GAGAAGCGCA AGACCATCAA
CGGCGACGAC CTCCTCTGGG CGATGACCAC GCTCGGCTTC GAGGACTACA TCGACCCGCT CAAGCTCTAC CTCCACAAGT
TCCGCGAGCT CGAGGGCGAG AAGGCCATCG GCGCCGCCGG CAGCGGCGGC GGTGGCGCCG CCTCCTCCGG CGGCTCCGGC
TCCGGCTCCG GCTCGCACCA CCACCAGGAT GCTTCCCGGA ACAATGGCGG ATACGGCATG TACGGCGGCG GCGGCGGCAT
GATCATGATG ATGGGACAGC CTATGTACGG CTCGCCGCCG GCGTCGTCAG CTGGGTACGC GCAGCCGCCG CCGCCCCACC
ACCACCACCA CCAGATGGTG ATGGGAGGGA AAGGTGCGTA TGGCCATGGC GGCGGCGGCG GCGGCGGGCC CTCCCCGTCG
TCGGGATACG GCCGGCAAGA CAGGCTATGA GCTTGCTTTC TTGGTTGGTG TTTTGGTAAT TAATTAATCA GAGGACATGT
CGGGTTAATT AATCTTAATC TCTGTTTTTT CACTCTTTTT TTTTACCTTT CTTTCTCTCT CTTTTATCTT TCCTTTTCTC
AATGTGCTAA AATGAGTCAA TTATATGGCT AAATTCTCTA CTAATTCGCT TC