Os07t0608200-01

Locus

Os07g0608200

Description

Similar to CCAAT-binding transcription factor subunit B (CBF-B) (NF-Y protein chain A) (NF-YA) (CAAT-box DNA binding protein subunit A). Splice isoform Short.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2G

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2G, NF-YA, CBF-B, NF-YA6, OsNF-YA6, NFYA6

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A6, NUCLEAR FACTOR-Y subunit NF-YA6, NF-YA transcription factor 6, NF-YA subunit 6, NF-YA family 6

Transcript Evidence

AK101684 (DDBJ, Best hit)

Protein Evidence

B6SPF1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Cellular Component: CCAAT-binding factor complex (GO:0016602)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

CCAAT-binding factor, conserved site (IPR018362)

Full-length cDNA

J033058N01 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0608200-01)

RiceXPro (AK101684)

Others

Oryzabase (8479)

KEGG (Os07t0608200-01)

Transcript

1411 bp

>Os07t0608200-01 Similar to CCAAT-binding transcription factor subunit B (CBF-B) (NF-Y protein chain A) (NF-YA) (CAAT-box DNA binding protein subunit A). Splice isoform Short.
ATAGAGCACAGTCCTCTCCTCTTCCCCGTGCTCCCCATTTCTGCTTCTTTTCCCACAAAT
TTCTCTCTCTATCTCGGAAAGGATTCGGGAGACTTGAAGAGAGGAGCTCGAAGCGGGACA
GGAGAGAGAGGCTAATTATAGAAGTACACGAAGAAAAATGGTGCCTGGACCAAAGTGAGA
CCATCTCATAATGCTAATGCTTTTGCGACAAATGGAAGATCATCGAGCCCATACTACGCC
CAACTATGATTTTTTCTCTGGAGATTATCAGATGAAGCAGTTAGGTCATAAGATGTATGA
TCAAGATTCCCCGTCAAGCGATTCTGGACAGTCACACCAAGAAGAATCTGCCATGAATGA
TAGCAGTCCAAATGAGCGACATACCTCAACACAATCTGACAATGATGATGGTCATCAGAT
GCCAGATCAGGACAAAACAAAGTCAGTATCATCGTTGGGGAATCCAGGAGCTTTGCCTCC
AAAGCTCAACTATAGCCAATCCTTTGCTTGTATTCCTTATACAGCTGATGCATACTATGG
TGGGGTCTTGACTGGATATTCTTCACATGCAATTGTTCATCCCCAGCAAAATGGTACAGC
TAACTCCCGGGTGCCGTTGCCTGTTGAGCCTGCAGCAGAAGAGCCAATATTTGTAAACGC
AAAGCAGTACCATGCAATTCTTAGGAGGAGACAGATACGAGCTAAATTGGAGGCCCAAAA
TAAGTTGGTGAAAGGTCGGAAGCCATACCTCCATGAATCTCGGCATCGCCATGCCATGAA
GCGAGCTCGTGGATCTGGAGGGCGCTTCCTCAACACAAAGCAGctcgaggagcagaagca
gcaacaggaggaggaggccgcatccggtggcgcgagCTCTGGCAATAGGACATGCCTTCA
GAATGGCACCGGTAGCGCGCCTTCAGCTTCCTCTCCCTCTGAAATCGCGAGCGTCTCAAC
CAGCAGAGAATTCCTTGGTAACCATGAGCAGAGCCACTTCCCCTCAGCTGGCTTCCTTCC
CACAATGAGCTTCAGAGCGCAGAATGGCGGAGATGGGAAGCTGGTCGCGAACGCCATTCA
CCAGCGCGTTTCCATGATGAGGTGAGGTGAAGAGGGGTGAAGTGGGTTCAGCTCAGCACC
ATCACTTTGGCTCTCTCCCTGCTGGTGGCAATTCATCCTTGGCTTATGAAAATACCTTAT
GGGAAAAAAAAAAGTAGTTTCATCCTCAAATGGACCAAACATGTGTGGCTCCATTTTAAG
TTTTCCTGTAACTAAAAGCACTGCAATGATCAACTGACTGTTGGTTCTGTTTGTGGATGC
TTATATCTGTACTTGCTGTATCTAATACTGAACTCTAAGTTGAAACCCTGAAACTGATGG
TCCCCGTGAATATTGTAGCTTGCATTTTATC

CDS

915 bp

>Os07t0608200-01 Similar to CCAAT-binding transcription factor subunit B (CBF-B) (NF-Y protein chain A) (NF-YA) (CAAT-box DNA binding protein subunit A). Splice isoform Short.
ATGCTAATGCTTTTGCGACAAATGGAAGATCATCGAGCCCATACTACGCCCAACTATGAT
TTTTTCTCTGGAGATTATCAGATGAAGCAGTTAGGTCATAAGATGTATGATCAAGATTCC
CCGTCAAGCGATTCTGGACAGTCACACCAAGAAGAATCTGCCATGAATGATAGCAGTCCA
AATGAGCGACATACCTCAACACAATCTGACAATGATGATGGTCATCAGATGCCAGATCAG
GACAAAACAAAGTCAGTATCATCGTTGGGGAATCCAGGAGCTTTGCCTCCAAAGCTCAAC
TATAGCCAATCCTTTGCTTGTATTCCTTATACAGCTGATGCATACTATGGTGGGGTCTTG
ACTGGATATTCTTCACATGCAATTGTTCATCCCCAGCAAAATGGTACAGCTAACTCCCGG
GTGCCGTTGCCTGTTGAGCCTGCAGCAGAAGAGCCAATATTTGTAAACGCAAAGCAGTAC
CATGCAATTCTTAGGAGGAGACAGATACGAGCTAAATTGGAGGCCCAAAATAAGTTGGTG
AAAGGTCGGAAGCCATACCTCCATGAATCTCGGCATCGCCATGCCATGAAGCGAGCTCGT
GGATCTGGAGGGCGCTTCCTCAACACAAAGCAGctcgaggagcagaagcagcaacaggag
gaggaggccgcatccggtggcgcgagCTCTGGCAATAGGACATGCCTTCAGAATGGCACC
GGTAGCGCGCCTTCAGCTTCCTCTCCCTCTGAAATCGCGAGCGTCTCAACCAGCAGAGAA
TTCCTTGGTAACCATGAGCAGAGCCACTTCCCCTCAGCTGGCTTCCTTCCCACAATGAGC
TTCAGAGCGCAGAATGGCGGAGATGGGAAGCTGGTCGCGAACGCCATTCACCAGCGCGTT
TCCATGATGAGGTGA

Protein

305 aa

>Os07t0608200-01 Similar to CCAAT-binding transcription factor subunit B (CBF-B) (NF-Y protein chain A) (NF-YA) (CAAT-box DNA binding protein subunit A). Splice isoform Short.
MLMLLRQMEDHRAHTTPNYDFFSGDYQMKQLGHKMYDQDSPSSDSGQSHQEESAMNDSSP
NERHTSTQSDNDDGHQMPDQDKTKSVSSLGNPGALPPKLNYSQSFACIPYTADAYYGGVL
TGYSSHAIVHPQQNGTANSRVPLPVEPAAEEPIFVNAKQYHAILRRRQIRAKLEAQNKLV
KGRKPYLHESRHRHAMKRARGSGGRFLNTKQLEEQKQQQEEEAASGGASSGNRTCLQNGT
GSAPSASSPSEIASVSTSREFLGNHEQSHFPSAGFLPTMSFRAQNGGDGKLVANAIHQRV
SMMR*

5'UTR

chr07:25001085..25001214 (- strand) : 130 bp

chr07:24999727..24999786 (- strand) : 60 bp

CDS

chr07:24999670..24999726 (- strand) : 57 bp

chr07:24999426..24999576 (- strand) : 151 bp

chr07:24998671..24998777 (- strand) : 107 bp

chr07:24998521..24998589 (- strand) : 69 bp

chr07:24997787..24997954 (- strand) : 168 bp

chr07:24997046..24997408 (- strand) : 363 bp

3'UTR

chr07:24996740..24997045 (- strand) : 306 bp

FASTA

>Os07t0608200-01 class=Sequence position=chr07:24996740..25001214 (- strand)
ATAGAGCACA GTCCTCTCCT CTTCCCCGTG CTCCCCATTT CTGCTTCTTT TCCCACAAAT TTCTCTCTCT ATCTCGGAAA
GGATTCGGGA GACTTGAAGA GAGGAGCTCG AAGCGGGACA GGAGAGAGAG GTACATCTCT ATGCGCGCCG CTGCGCTACT
CCCTCCTCGG AGAAATCCCC AAATTGTGTT CTTGCATGCG TCGTCCTAGT AGCAGAGAGC TGTCCCTTCC ATTTTCCTTT
CATGGAGTGG ATTCTTGGTT CTTGATTACG ACATGCTGTG TTTGGTCCAG TTCTTATCCC CTGCGATTTT TTCCCATTTC
TTTTCTCTCC CTTGTTCCAC CTCGGAAATT TGGGTTCTTT TTTTCTTCTT CTTTTGATTC TTGGTTGGTT TGTGTTGCAT
AATTTCAGTT CTTTGTTAGG CTTGCTTCGG AGTTGTAGTT AGACATCGCA AGATGCATCC TTTCGAGGAA GTCAATGCAT
CCCCTGTTGT TAGCTGACCA CTGTATATCG AATGCACTGT GAGTTGTGTT TTAGGCCGTG GAGTGGGTGG AAATTTGACT
TCCCCATTGC AGGATTTGGT AACTTGAAGC TAAATTCCGT GTGAATTTGT GACGGTATCA AGCGATTGTG TCTCTGATAA
GATTCTGAAT GTGTGAACTT GCTGCGATAT GTTCTGATTT ACTAGTGGTT TAGCTTTTCA ATCGTTATTC TGATTAAGAC
AAGGGACTTC TTCTGTGCAT ATGGATTGGC AATTTGGACT CGAGAACAAT CCACTAAAAG TTGTGTAGGT TATCTCTTTA
TGATCTGCAT GTAATAAATG TAAACCTGAG ACTGATGTAG GCTACCTCTT ATTCGAGAAA AAGAAAAAGA GGCTGATGTA
AGCTACCTAA TGTGCATTTT GTGCTTATTC CTCTTGATCA GGTTGTTTCT ATATAAGAAT TTTCTGTCTG TCTACTTAGG
GTAGGATGCT GTGTGTTATT TGTAGTGGTA CTCTTTTTAG GTTGATTTAT TTGTTTTTTT ATTCAGTTAT TTCCTACTCT
TGCAACAAGC ACTTAACAAC CTACTCTGCC TACTCTGTTC CTACTGAACA GTACCACTAt taagtattac cttattatga
tattaaggta atatcataat ttatttgctt ttatggttca gaatctcatg attcagttat ttcctaCTGT CTCTATTCAG
TATTACAACA TCTATTGTCG TTTTTTTTAG ATAATTCAAC ACCTGAAAGT AACTATGCAT AATCATATTC CAGTTAATGA
GTAGAAACCT TTAATAGGCA TCTTTTGATA GAAAGGATTA GAGCTAATCC TTTGATGGGC AACAAAATCC CCACCAATCT
GAAGAGGTCA GGTTAAAAGC CCTATCAGTT CAATTTGCTT AAGTTAATGT TATCAACTTG TCTTGAAGGC TAATTATAGA
AGTACACGAA GAAAAATGGT GCCTGGACCA AAGTGAGACC ATCTCATAAT GCTAATGCTT TTGCGACAAA TGGAAGATCA
TCGAGCCCAT ACTACGCCCA ACTATGTAAG TAGTAGTTAT TGATGGTGCA ACCTGGGAAT TGCTGGCTTT GCTACTCCCA
TGAGTAACAC ATTTACCAGC TAGACTCTGC ATGTGTAGGA TTTTTTCTCT GGAGATTATC AGATGAAGCA GTTAGGTCAT
AAGATGTATG ATCAAGATTC CCCGTCAAGC GATTCTGGAC AGTCACACCA AGAAGAATCT GCCATGAATG ATAGCAGTCC
AAATGAGCGA CATACCTCAA CACAATCTGG TAATGCATGA TATTTAAAAG TATTGTCATA ATGGTAATCC GGTCTTAGTA
TAGTTTCAGA TCTTATTGTC GCAACATATT CTTCGCTTCA ATCATGTCTC TTTAAAACAC ATTTGTAGAT GCTGCTTCTT
GGTTGGCAAT CGTTTGTCTA TGGATGTAGT GCCAAGTTGA ATGTATTCAT GATACCAATA CGTTCAATGA TTATTTGCAA
GCTCATCTAT GCTATAGTGC AAGTGACTTT ATGGTAGCTG TAAATTGTGA CGAGCTGCTG TGGTCTTAGG CAACCTTTTT
TCTGGATTAT GTGAACTTTT CATTTGAGTT TCCACATGAA ACCCATATTG GAACGAAGAG TATTATCATG TGTTTCCACA
TGATAATAGT TCATATGCGT CAAAACTCAA AACCATGTCA TCTGTTTTGT ATGTAATGCT CACGTTTCAA ATTTTCCTTT
ATTGTTGTTA TTACTATGCT TCTCACCAAA CCTTCGAGTA ATCTTTTGCA TATTCTGAAG TGACAGTTTT GATGAGTCTG
TCATTTCATT AGTGAGTTTT CCTGTTATTC CTTCTAGTGC TCAATTTACA TCGATTATCT CTGTTAATCA TTCCGGTGCC
CAACCTAACA TCTCGTTTGT CCTTTTTTCC CCCTCAGACA ATGATGATGG TCATCAGATG CCAGATCAGG ACAAAACAAA
GTCAGTATCA TCGTTGGGGA ATCCAGGAGC TTTGCCTCCA AAGCTCAACT ATAGCCAATC CTTTGTAAGT TCATGCAATT
GTGTGGATTG TTGCCCTCTT TGAATCAAGT GTTACTTTCA GTTGACCAGC TATGTTGTGT TCTAGGCTTG TATTCCTTAT
ACAGCTGATG CATACTATGG TGGGGTCTTG ACTGGATATT CTTCACATGC AATTGTGAGT TCACTCTACC ATTTCTGTTC
TCACATCAAA TTTGTACAAT CTTTGACGAT TCAAGGTGAT AAGATCATTT TTCTCCCCTC TTCATCCATT TACAATTTGA
TGAGCATCGA AGATCTTATT CATTCTGGTA GTTAAGCAAT TGTTGCAGTC GAGTATTATT CAGAAGCAAA ACAAAAGAGT
AGACAGGTGC TTTGAAATAA AAGAGAGGAA TTTGCAGGGG ACTCGTGCAT CCTTTTTGTT GAACTTCATT AATATTTAGA
AGGAAAAAAA ATAAAACAAC AAAGAGTCCT TTTAAATAAA ACTTAAAGGT GGGGAGTTTG CAATTGATTC ATGCATCTTT
TTTAGATTAA AGATCGTAGC TTCATCGATG GATTTTGGAC TTCGTACAAA CCATTTCTAA GCTTATCAGC TAAAAGATGC
CACCCAATCA AAACTGTCTT CCTGAGAAAC TAGATGATAT ATTGTATAAC ACTTATTTCG TGCATCTTCG CAGTACATTT
TTTTAAAATT TTCTTATGGC ACAGCATCAA CAATTTGTCA TTTGTGTATT ATTTACCCAG GTTCATCCCC AGCAAAATGG
TACAGCTAAC TCCCGGGTGC CGTTGCCTGT TGAGCCTGCA GCAGAAGAGC CAATATTTGT AAACGCAAAG CAGTACCATG
CAATTCTTAG GAGGAGACAG ATACGAGCTA AATTGGAGGC CCAAAATAAG TTGGTGAAAG GTCGGAAGGT AATACGAAAT
GTTGCAATCC TTCCTGGTAC CCTTTTTTTT TTCTTTCTGC TATGAAACTG TAAAAGAGAT GCTCCTGTTA GTACTTCCCT
AATTTTCTTA GATACATGCT GACTGCTGCA CTGCATCTTT ACATATCTTT CAGCTAAAAA TTCATTATCC TGCCTTGGGT
TACTTAGGGA GTTATCTGTG CTCAGAGTAC ATCTTTATGC TATTCATTGA TCAAAATATT TGGACTCAGT ATGTTTAAAG
TGATCACCAT CCTCAATCAC ATGGGTGATT CATTTCTCAA GGCAAAATAA TAGCTACTTA CAGCTATACA TTTTAACTTA
CAATTACCCC TGTTATAAGT TAAAAACATT TCTCCTGTCT TCTCAGCCAT ACCTCCATGA ATCTCGGCAT CGCCATGCCA
TGAAGCGAGC TCGTGGATCT GGAGGGCGCT TCCTCAACAC AAAGCAGctc gaggagcaga agcagcaaca ggaggaggag
gccgcatccg gtggcgcgag CTCTGGCAAT AGGACATGCC TTCAGAATGG CACCGGTAGC GCGCCTTCAG CTTCCTCTCC
CTCTGAAATC GCGAGCGTCT CAACCAGCAG AGAATTCCTT GGTAACCATG AGCAGAGCCA CTTCCCCTCA GCTGGCTTCC
TTCCCACAAT GAGCTTCAGA GCGCAGAATG GCGGAGATGG GAAGCTGGTC GCGAACGCCA TTCACCAGCG CGTTTCCATG
ATGAGGTGAG GTGAAGAGGG GTGAAGTGGG TTCAGCTCAG CACCATCACT TTGGCTCTCT CCCTGCTGGT GGCAATTCAT
CCTTGGCTTA TGAAAATACC TTATGGGAAA AAAAAAAGTA GTTTCATCCT CAAATGGACC AAACATGTGT GGCTCCATTT
TAAGTTTTCC TGTAACTAAA AGCACTGCAA TGATCAACTG ACTGTTGGTT CTGTTTGTGG ATGCTTATAT CTGTACTTGC
TGTATCTAAT ACTGAACTCT AAGTTGAAAC CCTGAAACTG ATGGTCCCCG TGAATATTGT AGCTTGCATT TTATC

Locus: Os07g0608200

Loading...

Locus: Os07g0608200

Loading...