Os07t0625800-01

Locus

Os07g0625800

Description

Plant lipid transfer protein/Par allergen family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLLA7, OsLTPG21, OsLTPg21, LLA7, LTPG21, LTPg21, OsHyPRP25, HyPRP25

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein-like AGP 7, non-specific lipid transfer protein-like arabinogalactan protein 7, GPI-anchored non-specific lipid transfer protein 21, type G nsLTP 21, type G non-specific lipid transfer protein 21, Hybrid Proline-Rich Protein 25

Transcript Evidence

AK103419 (DDBJ, Best hit)

Protein Evidence

A2YNW1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J033128J19 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0625800-01)

Others

Oryzabase (11334)

Transcript

956 bp

>Os07t0625800-01 Plant lipid transfer protein/Par allergen family protein.
AGCCGCCGCCACGTGCCGCATTGATGGTCCCGGCAACCATCCAGCGCGTAACCGATTCCC
TGTACATTCGGCCGCGATAACTATCTCTTTCTCCCCTATAATTAATCTCGCCGGAGTCCT
CGCCGCGAACCCACCACCACTGCAATCTCGCCCCGCCGCACGCACTCCACTAGCTACCAT
CTTGAATTCTTGATTGCTCGGCCGGCACAGCTATGTCGCGCGCCGTAGTTGTGGTGGTGG
TGGTGGCCGTGCTGGCGCTGGCGTGCGGCGCGGCGTCGCAGTCGCCGGCGCCGGCGCCGG
CGGCGGGGCCGGCGTCGGACTGCGGGTCGTCGATCACGGCGCTGGCGGGGTGCCTGACGT
ACATCACGCCGGGGAGCCCCGAGGCGAGGCCGGCCAAGGACTGCTGCGCCGGCGTGAAGA
GCGCGCTGGGCAGCCCGGCCGCCGTCGCCTGCCTCTGCGGCGCGCTCGGCCAGGACTTCG
GCATCAAGATCAACTACACCCGCGCCGCCGCCCTCCCCGCCGCCTGCGGCGGCGACTCCT
CCGCCCTGAGCAAGTGCAACAAGAAATTTCCCGGTGCCTCTCCTACTGGAGCACCCGCAC
CATCTTCTTCCGGTTCTGGGTCAGGATCAACACCGGCCACCGGCACGCCATCTTCACCGA
AGTCGGCGGCGGCCCAATCTCCGGTCTCGGCGATGCTCATTGTAGCCACGGTTGCTGCAC
CTCTGCTTTCTTACTATTACCTCTGAAGATTTTTACCACATATGATCTAGTTTCTGAAAC
GCTGTGATTTGTATGCGCATTGCGCTGTGATTTATCAGTGACTCTTTTAGGGAGAGATCT
GCTAATGTTGACTTCTATAGCCGTGCCCGTGGTGCCATTTCTCACTGTTTCCTGGATTGC
TATTAGTTTGTACAATATTGGGATGGTTCATTCAGAATAAAGTAGAAAAATGAAGC

CDS

534 bp

>Os07t0625800-01 Plant lipid transfer protein/Par allergen family protein.
ATGTCGCGCGCCGTAGTTGTGGTGGTGGTGGTGGCCGTGCTGGCGCTGGCGTGCGGCGCG
GCGTCGCAGTCGCCGGCGCCGGCGCCGGCGGCGGGGCCGGCGTCGGACTGCGGGTCGTCG
ATCACGGCGCTGGCGGGGTGCCTGACGTACATCACGCCGGGGAGCCCCGAGGCGAGGCCG
GCCAAGGACTGCTGCGCCGGCGTGAAGAGCGCGCTGGGCAGCCCGGCCGCCGTCGCCTGC
CTCTGCGGCGCGCTCGGCCAGGACTTCGGCATCAAGATCAACTACACCCGCGCCGCCGCC
CTCCCCGCCGCCTGCGGCGGCGACTCCTCCGCCCTGAGCAAGTGCAACAAGAAATTTCCC
GGTGCCTCTCCTACTGGAGCACCCGCACCATCTTCTTCCGGTTCTGGGTCAGGATCAACA
CCGGCCACCGGCACGCCATCTTCACCGAAGTCGGCGGCGGCCCAATCTCCGGTCTCGGCG
ATGCTCATTGTAGCCACGGTTGCTGCACCTCTGCTTTCTTACTATTACCTCTGA

Protein

178 aa

>Os07t0625800-01 Plant lipid transfer protein/Par allergen family protein.
MSRAVVVVVVVAVLALACGAASQSPAPAPAAGPASDCGSSITALAGCLTYITPGSPEARP
AKDCCAGVKSALGSPAAVACLCGALGQDFGIKINYTRAAALPAACGGDSSALSKCNKKFP
GASPTGAPAPSSSGSGSGSTPATGTPSSPKSAAAQSPVSAMLIVATVAAPLLSYYYL*

5'UTR

chr07:25922660..25922871 (- strand) : 212 bp

CDS

chr07:25922311..25922659 (- strand) : 349 bp

chr07:25921835..25921864 (- strand) : 30 bp

chr07:25920909..25921063 (- strand) : 155 bp

3'UTR

chr07:25920699..25920908 (- strand) : 210 bp

FASTA

>Os07t0625800-01 class=Sequence position=chr07:25920699..25922871 (- strand)
AGCCGCCGCC ACGTGCCGCA TTGATGGTCC CGGCAACCAT CCAGCGCGTA ACCGATTCCC TGTACATTCG GCCGCGATAA
CTATCTCTTT CTCCCCTATA ATTAATCTCG CCGGAGTCCT CGCCGCGAAC CCACCACCAC TGCAATCTCG CCCCGCCGCA
CGCACTCCAC TAGCTACCAT CTTGAATTCT TGATTGCTCG GCCGGCACAG CTATGTCGCG CGCCGTAGTT GTGGTGGTGG
TGGTGGCCGT GCTGGCGCTG GCGTGCGGCG CGGCGTCGCA GTCGCCGGCG CCGGCGCCGG CGGCGGGGCC GGCGTCGGAC
TGCGGGTCGT CGATCACGGC GCTGGCGGGG TGCCTGACGT ACATCACGCC GGGGAGCCCC GAGGCGAGGC CGGCCAAGGA
CTGCTGCGCC GGCGTGAAGA GCGCGCTGGG CAGCCCGGCC GCCGTCGCCT GCCTCTGCGG CGCGCTCGGC CAGGACTTCG
GCATCAAGAT CAACTACACC CGCGCCGCCG CCCTCCCCGC CGCCTGCGGC GGCGACTCCT CCGCCCTGAG CAAGTGCAAC
AGTCAGTACA ACCAACTCAC TCCTCCGATT TGTTTCTTCA TCTCTGTTTT TTTTTTTCAA TTTTTTCTTC GTTTTATTCT
TCTGTCTTTT TGGGTGACTA TGGTTAGTAA AACTTTACAT TTCCCTTTAT ATAGTACTCC GTAGTACTTG GTTATAGATC
AATTTATCGA TTTGTTTCTT CATCTCTGTT TATTTTTCGT TTTACTCTTC TCTGTCTTTT TGGGTGACTA TGGTTAGTAA
AACTTTACAT TTCCCTTTAG TACTTGGTTA TAGATCAATT TATCGATTTG TTTCTTCAAT TATTTTTTCG TTTTATTCTT
CTGTGTCTTT TTGGGTGACT ATGGTTAGTA AAACTTTGCA TTTCCCTTTA TATAGTAGTA CTTGGTTATA GATCGATTTA
TAGTTTGTAT ATGTATATAA TTTGATCTCT TTTTTTTTTC TTGGCAGAGA AATTTCCCGG TGCCTCTCCT ACTGGAGGTA
AAGCAAAATC CTGAATCCCT GTCTGATTGT TCTTGTCGAT CTGATTTCAA TTTTGATGTA AATGAATCAA ATAAAGGATT
TCCTGCCTAA TTATCCTCAG TTTTGCTCCC TATAACTGAA ATTTGTCCCA GAGAATGGTC ATTTTTATTT AAAAATGAAA
AAAGTAAAAC AAGATAAAAA ACAAAAGAAA CTTTAAATTC TAAATCATCA GCAGAGTAGA TGGCTGGTCC TTCCTGATGA
CTTCCTCTCC TCATTAGTCA CTACTCGCTA CTAGTACTAC TAGTAGATCT GATCATCTTA GTAGAATTTT CCCATTATTA
TGTTCTCTAT GCAAGTGGTG TACCTGCTAC CTGGCGTTGT GGTTGTTGTG GTGCCTGGCA TAGTTGGCAG CCAAATTTTG
TAATCCATCA TGCACACTAA AAAAGAACTG AACAAACTTT CTGTGGGGTA ACCAACTCAC CATCTACTGC ACATTGATGA
GGATTCATTA TCTAAAGTTA TCTGAAAGTT CTGACTTCTG AAATCAATGT GAGGTCTGAA AGTGAAAGCT CTCCGAAGAC
CTCATGACTG ATAAGAAGAT ATTTTGCGTT GATAAACATT TTCTGACTTC TTCTACTAAT TACAAACAAA AAATTTGGAT
CCTGGAGTTC TGAACCCAAT GAAATATTCT GCCCTGCTGA CATGTATTCA CCAATTCATC TTTTAGAAAT TATAATTGCT
TGGATATGTG GTATCTGGCC ATCTCACAAT TCTGCATCAA TGTTGCAGCA CCCGCACCAT CTTCTTCCGG TTCTGGGTCA
GGATCAACAC CGGCCACCGG CACGCCATCT TCACCGAAGT CGGCGGCGGC CCAATCTCCG GTCTCGGCGA TGCTCATTGT
AGCCACGGTT GCTGCACCTC TGCTTTCTTA CTATTACCTC TGAAGATTTT TACCACATAT GATCTAGTTT CTGAAACGCT
GTGATTTGTA TGCGCATTGC GCTGTGATTT ATCAGTGACT CTTTTAGGGA GAGATCTGCT AATGTTGACT TCTATAGCCG
TGCCCGTGGT GCCATTTCTC ACTGTTTCCT GGATTGCTAT TAGTTTGTAC AATATTGGGA TGGTTCATTC AGAATAAAGT
AGAAAAATGA AGC

Locus: Os07g0625800

Loading...

Locus: Os07g0625800

Loading...