Os07t0625800-02

Locus

Os07g0625800

Description

Plant lipid transfer protein/Par allergen family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLLA7, OsLTPG21, OsLTPg21, LLA7, LTPG21, LTPg21, OsHyPRP25, HyPRP25

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein-like AGP 7, non-specific lipid transfer protein-like arabinogalactan protein 7, GPI-anchored non-specific lipid transfer protein 21, type G nsLTP 21, type G non-specific lipid transfer protein 21, Hybrid Proline-Rich Protein 25

Transcript Evidence

AK073694 (DDBJ, Best hit)

Protein Evidence

A2YNW1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J033060N23 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0625800-02)

Others

Oryzabase (11334)

Transcript

826 bp

>Os07t0625800-02 Plant lipid transfer protein/Par allergen family protein.
CCACCACCACTGCAATCTCGCCCCGCCGCACGCACTCCACTAGCTACCATCTTGAATTCT
TGATTGCTCGGCCGGCACAGCTATGTCGCGCGCCGTAGTTGTGGTGGTGGTGGTGGCCGT
GCTGGCGCTGGCGTGCGGCGCGGCGTCGCAGTCGCCGGCGCCGGCGCCGGCGGCGGGGCC
GGCGTCGGACTGCGGGTCGTCGATCACGGCGCTGGCGGGGTGCCTGACGTACATCACGCC
GGGGAGCCCCGAGGCGAGGCCGGCCAAGGACTGCTGCGCCGGCGTGAAGAGCGCGCTGGG
CAGCCCGGCCGCCGTCGCCTGCCTCTGCGGCGCGCTCGGCCAGGACTTCGGCATCAAGAT
CAACTACACCCGCGCCGCCGCCCTCCCCGCCGCCTGCGGCGGCGACTCCTCCGCCCTGAG
CAAGTGCAACAAGAAATTTCCCGGTGCCTCTCCTACTGGAGCACCCGCACCATCTTCTTC
CGGTTCTGGGTCAGGATCAACACCGGCCACCGGCACGCCATCTTCACCGAAGTCGGCGGC
GGCCCAATCTCCGGTCTCGGCGATGCTCATTGTAGCCACGGTTGCTGCACCTCTGCTTTC
TTACTATTACCTCTGAAGATTTTTACCACATATGATCTAGTTTCTGAAACGCTGTGATTT
GTATGCGCATTGCGCTGTGATTTATCAGTGACTCTTTTAGGGAGAGATCTGCTAATGTTG
ACTTCTATAGCCGTGCCCGTGGTGCCATTTCTCACTGTTTCCTGGATTGCTATTAGTTTG
TACAATATTGGGATGGTTCATTCAGAATAAAGTAGAAAAATGAAGC

CDS

534 bp

>Os07t0625800-02 Plant lipid transfer protein/Par allergen family protein.
ATGTCGCGCGCCGTAGTTGTGGTGGTGGTGGTGGCCGTGCTGGCGCTGGCGTGCGGCGCG
GCGTCGCAGTCGCCGGCGCCGGCGCCGGCGGCGGGGCCGGCGTCGGACTGCGGGTCGTCG
ATCACGGCGCTGGCGGGGTGCCTGACGTACATCACGCCGGGGAGCCCCGAGGCGAGGCCG
GCCAAGGACTGCTGCGCCGGCGTGAAGAGCGCGCTGGGCAGCCCGGCCGCCGTCGCCTGC
CTCTGCGGCGCGCTCGGCCAGGACTTCGGCATCAAGATCAACTACACCCGCGCCGCCGCC
CTCCCCGCCGCCTGCGGCGGCGACTCCTCCGCCCTGAGCAAGTGCAACAAGAAATTTCCC
GGTGCCTCTCCTACTGGAGCACCCGCACCATCTTCTTCCGGTTCTGGGTCAGGATCAACA
CCGGCCACCGGCACGCCATCTTCACCGAAGTCGGCGGCGGCCCAATCTCCGGTCTCGGCG
ATGCTCATTGTAGCCACGGTTGCTGCACCTCTGCTTTCTTACTATTACCTCTGA

Protein

178 aa

>Os07t0625800-02 Plant lipid transfer protein/Par allergen family protein.
MSRAVVVVVVVAVLALACGAASQSPAPAPAAGPASDCGSSITALAGCLTYITPGSPEARP
AKDCCAGVKSALGSPAAVACLCGALGQDFGIKINYTRAAALPAACGGDSSALSKCNKKFP
GASPTGAPAPSSSGSGSGSTPATGTPSSPKSAAAQSPVSAMLIVATVAAPLLSYYYL*

5'UTR

chr07:25922660..25922741 (- strand) : 82 bp

CDS

chr07:25922311..25922659 (- strand) : 349 bp

chr07:25921835..25921864 (- strand) : 30 bp

chr07:25920909..25921063 (- strand) : 155 bp

3'UTR

chr07:25920699..25920908 (- strand) : 210 bp

FASTA

>Os07t0625800-02 class=Sequence position=chr07:25920699..25922741 (- strand)
CCACCACCAC TGCAATCTCG CCCCGCCGCA CGCACTCCAC TAGCTACCAT CTTGAATTCT TGATTGCTCG GCCGGCACAG
CTATGTCGCG CGCCGTAGTT GTGGTGGTGG TGGTGGCCGT GCTGGCGCTG GCGTGCGGCG CGGCGTCGCA GTCGCCGGCG
CCGGCGCCGG CGGCGGGGCC GGCGTCGGAC TGCGGGTCGT CGATCACGGC GCTGGCGGGG TGCCTGACGT ACATCACGCC
GGGGAGCCCC GAGGCGAGGC CGGCCAAGGA CTGCTGCGCC GGCGTGAAGA GCGCGCTGGG CAGCCCGGCC GCCGTCGCCT
GCCTCTGCGG CGCGCTCGGC CAGGACTTCG GCATCAAGAT CAACTACACC CGCGCCGCCG CCCTCCCCGC CGCCTGCGGC
GGCGACTCCT CCGCCCTGAG CAAGTGCAAC AGTCAGTACA ACCAACTCAC TCCTCCGATT TGTTTCTTCA TCTCTGTTTT
TTTTTTTCAA TTTTTTCTTC GTTTTATTCT TCTGTCTTTT TGGGTGACTA TGGTTAGTAA AACTTTACAT TTCCCTTTAT
ATAGTACTCC GTAGTACTTG GTTATAGATC AATTTATCGA TTTGTTTCTT CATCTCTGTT TATTTTTCGT TTTACTCTTC
TCTGTCTTTT TGGGTGACTA TGGTTAGTAA AACTTTACAT TTCCCTTTAG TACTTGGTTA TAGATCAATT TATCGATTTG
TTTCTTCAAT TATTTTTTCG TTTTATTCTT CTGTGTCTTT TTGGGTGACT ATGGTTAGTA AAACTTTGCA TTTCCCTTTA
TATAGTAGTA CTTGGTTATA GATCGATTTA TAGTTTGTAT ATGTATATAA TTTGATCTCT TTTTTTTTTC TTGGCAGAGA
AATTTCCCGG TGCCTCTCCT ACTGGAGGTA AAGCAAAATC CTGAATCCCT GTCTGATTGT TCTTGTCGAT CTGATTTCAA
TTTTGATGTA AATGAATCAA ATAAAGGATT TCCTGCCTAA TTATCCTCAG TTTTGCTCCC TATAACTGAA ATTTGTCCCA
GAGAATGGTC ATTTTTATTT AAAAATGAAA AAAGTAAAAC AAGATAAAAA ACAAAAGAAA CTTTAAATTC TAAATCATCA
GCAGAGTAGA TGGCTGGTCC TTCCTGATGA CTTCCTCTCC TCATTAGTCA CTACTCGCTA CTAGTACTAC TAGTAGATCT
GATCATCTTA GTAGAATTTT CCCATTATTA TGTTCTCTAT GCAAGTGGTG TACCTGCTAC CTGGCGTTGT GGTTGTTGTG
GTGCCTGGCA TAGTTGGCAG CCAAATTTTG TAATCCATCA TGCACACTAA AAAAGAACTG AACAAACTTT CTGTGGGGTA
ACCAACTCAC CATCTACTGC ACATTGATGA GGATTCATTA TCTAAAGTTA TCTGAAAGTT CTGACTTCTG AAATCAATGT
GAGGTCTGAA AGTGAAAGCT CTCCGAAGAC CTCATGACTG ATAAGAAGAT ATTTTGCGTT GATAAACATT TTCTGACTTC
TTCTACTAAT TACAAACAAA AAATTTGGAT CCTGGAGTTC TGAACCCAAT GAAATATTCT GCCCTGCTGA CATGTATTCA
CCAATTCATC TTTTAGAAAT TATAATTGCT TGGATATGTG GTATCTGGCC ATCTCACAAT TCTGCATCAA TGTTGCAGCA
CCCGCACCAT CTTCTTCCGG TTCTGGGTCA GGATCAACAC CGGCCACCGG CACGCCATCT TCACCGAAGT CGGCGGCGGC
CCAATCTCCG GTCTCGGCGA TGCTCATTGT AGCCACGGTT GCTGCACCTC TGCTTTCTTA CTATTACCTC TGAAGATTTT
TACCACATAT GATCTAGTTT CTGAAACGCT GTGATTTGTA TGCGCATTGC GCTGTGATTT ATCAGTGACT CTTTTAGGGA
GAGATCTGCT AATGTTGACT TCTATAGCCG TGCCCGTGGT GCCATTTCTC ACTGTTTCCT GGATTGCTAT TAGTTTGTAC
AATATTGGGA TGGTTCATTC AGAATAAAGT AGAAAAATGA AGC

Locus: Os07g0625800

Loading...

Locus: Os07g0625800

Loading...