Os07t0647200-00

Locus

Os07g0647200

Description

Similar to Cytochrome P450 CYP734A7.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP734A5

CGSNL Gene Name

CYTOCHROME P450 HYDROXYLASE 734A5

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AB488668 (DDBJ, Best hit)

Protein Evidence

B6U8A2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Expression Databases

TENOR (Os07t0647200-00)

Others

Oryzabase (14297)

KEGG (Os07t0647200-00 (EC:1.14.14.1))

Transcript

1518 bp

>Os07t0647200-00 Similar to Cytochrome P450 CYP734A7.
ATGTGGTCGTCGTGGGCGTGGACGTGGAGCTGGAGCGGCGCGGCGGCCGTGGCCGTGGCG
GCGGCGGCGGCGTGGGTGGCGGTGTACGCGGCGGCGGCGAGGGCGGCGGAGGCGCTGTGG
TGGCGGCCGCGGCGGGTGGAGCGGCACTTCGCGGCGCAGGGGGTGCGGGGGCCGGGGTAC
CGGTTCTTCGTGGGGAGCTCGATCGAGCTCGTCCGCCTCATGGTGGACGCCGCCTCCCGC
CCCATGGAGCCACCCACCTCCCACGACATCCTCCCCCGCGTCCTCCCCTTCTACCACCAT
TGGAGGAAGCTCTACGGTCCGATGCATTTGATTTGGTTTGGGCGGACGCCGAGGTTGGTG
GTGAGCGAGCCGGAGCTGATCCGGGAGGTGCTCCTGACGCGGGCGGATCACTTCGACCGG
TACGAGGCGCACCCGATGATCTGCCAGTTCGAGGGCTACGGCCTCAGCAACCTCCACGGC
GAGCGGTGGGCGCGCCGCCGCCGGGTGCTCACGCCGGCGTTCCACACCGAGAACGTCGAC
GTCGCCGAGTGGTTCCAGCGCGTGCCGCAGGAGGCCATCACGTTCGCCGCGTTCGGCCGC
CGGAACTACGACGACGGCGCCGCCGTGTTCCGGCTCCAGGACGAGCTCGCCGGCTACGCC
ACCGAGGCGCACAGCAAGGTGTACATCCCCGGGTACAGGTTCCTCCCCACGAGGAAGAAC
CGCCGCGTGTGGCAGCTCGACAGGGAGATCAGGAGCCACCTCGCCAAGTTCGTCACCGGC
CTGCAGAGCTGCAGCAGCAGCCATGGCGACGACGCCGATGATGGCGGCGATGGCGGCGGC
GGCATGAGGGAGTTCATGAGCTTCATGGCGCCGGCGATGACGGCGGGCGAGATCATCGAG
GAGAGCAAGAACTTCTTCTTCGCCGGGAAGGAGACGCTGTCCAACCTCCTCACCTGGACC
ACCGTCGCGCTCGCCATGCACCCGGAGTGGCAGGAACGTGCCCGCCGCGAGGTCGTCGCC
GTCTGCGGCCGTGGCGACCTCCCCACCAAGGACCACCTCCCCAAGCTCAAAACCCTCGGG
ATGATCTTGAACGAGACGCTGAGGCTGTACCCGCCGGCGGTGGCGATGATACGGACGGCG
AAGGAGGACGTGGAGCTGGGCGGGTGCGTGGTGCCGGCGGGGACGGAGGTGATGATCCCG
ATCATGGCCGTCCACCACGACGCGGCGGCGTGGGGCGACGACGCCGCGGAGTTCAACCCG
GCGAGGTTCGCCGCCGACGACGACGGCGGCCGGCGCCGCCACCCGATGGCGTTCATGCCG
TTCGGCGGCGGCGCGCGGGTGTGCATCGGCCAGAACATGGCGCTCATGGAGGCCAAGGTG
GCGCTCGCCGTCGTCCTGCGGCGCTTCGAGTTCCGGCTATCGCCGGCGTACGTGCACGCG
CCCAGGGTGCTCATGATACTCAGCCCGCAGTTCGGCGCGCCGGTGATCTTCCGGCCGCTG
ACGTCAGCCGCAGCTTAG

CDS

1518 bp

>Os07t0647200-00 Similar to Cytochrome P450 CYP734A7.
ATGTGGTCGTCGTGGGCGTGGACGTGGAGCTGGAGCGGCGCGGCGGCCGTGGCCGTGGCG
GCGGCGGCGGCGTGGGTGGCGGTGTACGCGGCGGCGGCGAGGGCGGCGGAGGCGCTGTGG
TGGCGGCCGCGGCGGGTGGAGCGGCACTTCGCGGCGCAGGGGGTGCGGGGGCCGGGGTAC
CGGTTCTTCGTGGGGAGCTCGATCGAGCTCGTCCGCCTCATGGTGGACGCCGCCTCCCGC
CCCATGGAGCCACCCACCTCCCACGACATCCTCCCCCGCGTCCTCCCCTTCTACCACCAT
TGGAGGAAGCTCTACGGTCCGATGCATTTGATTTGGTTTGGGCGGACGCCGAGGTTGGTG
GTGAGCGAGCCGGAGCTGATCCGGGAGGTGCTCCTGACGCGGGCGGATCACTTCGACCGG
TACGAGGCGCACCCGATGATCTGCCAGTTCGAGGGCTACGGCCTCAGCAACCTCCACGGC
GAGCGGTGGGCGCGCCGCCGCCGGGTGCTCACGCCGGCGTTCCACACCGAGAACGTCGAC
GTCGCCGAGTGGTTCCAGCGCGTGCCGCAGGAGGCCATCACGTTCGCCGCGTTCGGCCGC
CGGAACTACGACGACGGCGCCGCCGTGTTCCGGCTCCAGGACGAGCTCGCCGGCTACGCC
ACCGAGGCGCACAGCAAGGTGTACATCCCCGGGTACAGGTTCCTCCCCACGAGGAAGAAC
CGCCGCGTGTGGCAGCTCGACAGGGAGATCAGGAGCCACCTCGCCAAGTTCGTCACCGGC
CTGCAGAGCTGCAGCAGCAGCCATGGCGACGACGCCGATGATGGCGGCGATGGCGGCGGC
GGCATGAGGGAGTTCATGAGCTTCATGGCGCCGGCGATGACGGCGGGCGAGATCATCGAG
GAGAGCAAGAACTTCTTCTTCGCCGGGAAGGAGACGCTGTCCAACCTCCTCACCTGGACC
ACCGTCGCGCTCGCCATGCACCCGGAGTGGCAGGAACGTGCCCGCCGCGAGGTCGTCGCC
GTCTGCGGCCGTGGCGACCTCCCCACCAAGGACCACCTCCCCAAGCTCAAAACCCTCGGG
ATGATCTTGAACGAGACGCTGAGGCTGTACCCGCCGGCGGTGGCGATGATACGGACGGCG
AAGGAGGACGTGGAGCTGGGCGGGTGCGTGGTGCCGGCGGGGACGGAGGTGATGATCCCG
ATCATGGCCGTCCACCACGACGCGGCGGCGTGGGGCGACGACGCCGCGGAGTTCAACCCG
GCGAGGTTCGCCGCCGACGACGACGGCGGCCGGCGCCGCCACCCGATGGCGTTCATGCCG
TTCGGCGGCGGCGCGCGGGTGTGCATCGGCCAGAACATGGCGCTCATGGAGGCCAAGGTG
GCGCTCGCCGTCGTCCTGCGGCGCTTCGAGTTCCGGCTATCGCCGGCGTACGTGCACGCG
CCCAGGGTGCTCATGATACTCAGCCCGCAGTTCGGCGCGCCGGTGATCTTCCGGCCGCTG
ACGTCAGCCGCAGCTTAG

Protein

506 aa

>Os07t0647200-00 Similar to Cytochrome P450 CYP734A7.
MWSSWAWTWSWSGAAAVAVAAAAAWVAVYAAAARAAEALWWRPRRVERHFAAQGVRGPGY
RFFVGSSIELVRLMVDAASRPMEPPTSHDILPRVLPFYHHWRKLYGPMHLIWFGRTPRLV
VSEPELIREVLLTRADHFDRYEAHPMICQFEGYGLSNLHGERWARRRRVLTPAFHTENVD
VAEWFQRVPQEAITFAAFGRRNYDDGAAVFRLQDELAGYATEAHSKVYIPGYRFLPTRKN
RRVWQLDREIRSHLAKFVTGLQSCSSSHGDDADDGGDGGGGMREFMSFMAPAMTAGEIIE
ESKNFFFAGKETLSNLLTWTTVALAMHPEWQERARREVVAVCGRGDLPTKDHLPKLKTLG
MILNETLRLYPPAVAMIRTAKEDVELGGCVVPAGTEVMIPIMAVHHDAAAWGDDAAEFNP
ARFAADDDGGRRRHPMAFMPFGGGARVCIGQNMALMEAKVALAVVLRRFEFRLSPAYVHA
PRVLMILSPQFGAPVIFRPLTSAAA*

CDS

chr07:27023203..27023518 (- strand) : 316 bp

chr07:27020891..27021108 (- strand) : 218 bp

chr07:27020255..27020794 (- strand) : 540 bp

chr07:27019245..27019688 (- strand) : 444 bp

FASTA

>Os07t0647200-00 class=Sequence position=chr07:27019245..27023518 (- strand)
ATGTGGTCGT CGTGGGCGTG GACGTGGAGC TGGAGCGGCG CGGCGGCCGT GGCCGTGGCG GCGGCGGCGG CGTGGGTGGC
GGTGTACGCG GCGGCGGCGA GGGCGGCGGA GGCGCTGTGG TGGCGGCCGC GGCGGGTGGA GCGGCACTTC GCGGCGCAGG
GGGTGCGGGG GCCGGGGTAC CGGTTCTTCG TGGGGAGCTC GATCGAGCTC GTCCGCCTCA TGGTGGACGC CGCCTCCCGC
CCCATGGAGC CACCCACCTC CCACGACATC CTCCCCCGCG TCCTCCCCTT CTACCACCAT TGGAGGAAGC TCTACGGTAA
TCAATCAACA CCACCTCGAT CGATCACCCT CTAATTAATT AATCTCCATT TCATTCAAAA AAAATTTCTC TCTCTAGTTC
CACTCTCCAA TTTAATTTCA CTCTTATTGA TCGATGTGCA TGCATACTTA CTATAACTTT GAAATTTCAA ATTGGTGATT
TTGTTTCTCA TTTTTGTTTC GATTTTCACA CGAATCATAT TTTTACATAT GAAATTGGCA ACACTTTCAC ACGAAAAAAT
AAGAAGAAAT TAACCAACTT GGGGCATTTG ATGGATATGT ATACTTATAT ATAGtactcc ctccgtttca aaatgtttga
caccgttgac tttttagcac atatttaacc gttcgtctta ttcaaaaact tttgtgaaat atgaaaaatt atatgtctac
atagaaatat atttaacaat gaatcaaatg ataggaaaag aattaataat tacttaattt ttttaataag acgaacggtc
aaacatgtgc taaagtcaac gatgtcaaac attttgaaac ggagggagta GTATATATAT GAGTATACGC GTAGGCTATC
ACGCGTGAAC GCGGAGGGAA TTAGGAAGGG GACAAGGTTC CATGCTTTTG CAAGTAGAAA CAAGGATGCA AAAGGTTAAA
TTATGGTTGA TTAGGTGGAG ATGAGAGCTT CATTTCGTTT CATATTTCAC TTTTGCTGGG TGTGGGTAGT AGCTAGTAGT
ACTAGCTAGG TGTACTAGCA CTGCATGCCT CCTCTCCACT ACTACTTGCT CTTTGATAAC CAAAAAAAAA AAATGCTGCA
GCTAGCTATT CTCTCTCCGT AATATCAAAT ATAAAAATTT CAAGAATTCA AATGTTGTAT ATAATACAAA TAATTTTGGG
ACACGGACGT AATTCAATCA TTTTCAGCCC ATTGAGATCG AGTGCTTAGG AGGGGAATCC AAGTAATTCA AAATTTGATC
AATGAAGTGA CTAAGAAGGA TTTTGCCCTC TTAATCCACT AAACAACCTT CAAATGCTTA TATTCAGAAG CGAAGGAAGT
ATAGCTAGCC AGCCTCCCAA GTCAAACTTG GTGATGTTGT CATCACTGAT CACAATGCAT GATTCATCCA TCCATCCATG
GATCTTTCCA ACAGGCTGTC AATGTAGGTT AATGATCATG TGAGTGAGTA ATTAATTAAA TAAACAAGAG CTTAATTAGC
TAGCTTACCT TAGCTTGGCT TAGCTCACAT CCATGCAGAT CCATCCGGCA GTTCAGAATT TCAGAGGACA CACTACCCAC
ATGCAGGCTT GCTTAGCAAT GAGTCCTCCT TGCAGCTGAT GCATACTTGC ATATGACTAT ATCAACAGCA GCTAGCATCT
CCTGCACATT GCCAGAGCAT TTCAGTTCAT GATCTGGTTT GCTTTCTGCT ATGCTCCGAT TAGTTTATCT CATTAATTGT
CACGGCAGCC GATGATAATT CCCTCTTTTT CAACGGTTTG TGGAGTATAA TATGCTCGAA GTTAGCTACC TACAGGCATG
CACCCGCGTT TAATCCAAGT GAGGAATCTT ATTGTTGATC GGTCGGTCAG TTAAGAAATG ATGAAGTTAA TCGTCGTCTG
TCAGTTCCAG TGACGGTTTG TTTTGGCAAT TTGTTTACAA CTCAATAGAT CATGAGCATC ACATTGATGC TGGCTGCGTG
TTCTTTGAAT CTGTCAAAGT TGACCACCTA CATACACATG CACATATAGT TTCTTTCCAG TGTCAATCTC TACCGTCCAA
TTCTCATCGG ACGGTCGGAA AATCAAGTCC AAATGCACCC TTATTTATTT CCACTGCCAC TGAGCTGATA TGGCAAAATG
ACAATAGGAA GGACCCCTTT GGAATGAATG GATTTTACGA GAATTTTCCT TAGAATCGAA CGTATTCTTG TAAAATTCCT
ATGTTTCAAA GGAGCCTAAA AAGTGTTCCG ACCCCACTTT ATTACTAACA TTTGATAAAG CCGGTGGATA GCAGGCTAGC
TAGATATAAC ATTTGCTTCG TCGAGGCTCA AGAAAATTTC TGATTATCTC TTGGTGGTAA ATTTTTGAAT AATTTGAAAT
TTACCAACAG GTCCGATGCA TTTGATTTGG TTTGGGCGGA CGCCGAGGTT GGTGGTGAGC GAGCCGGAGC TGATCCGGGA
GGTGCTCCTG ACGCGGGCGG ATCACTTCGA CCGGTACGAG GCGCACCCGA TGATCTGCCA GTTCGAGGGC TACGGCCTCA
GCAACCTCCA CGGCGAGCGG TGGGCGCGCC GCCGCCGGGT GCTCACGCCG GCGTTCCACA CCGAGAACCT CAGGATGATC
GCGCCGTTCG TCGCCGGCAC CGTCACCCGC ATGCTCGACG AGCTGGCGGA GCGCGCGCGC GCCGGCGGCG CCGGCGAGGC
GGAGGTCGAC GTCGCCGAGT GGTTCCAGCG CGTGCCGCAG GAGGCCATCA CGTTCGCCGC GTTCGGCCGC CGGAACTACG
ACGACGGCGC CGCCGTGTTC CGGCTCCAGG ACGAGCTCGC CGGCTACGCC ACCGAGGCGC ACAGCAAGGT GTACATCCCC
GGGTACAGGT TCCTCCCCAC GAGGAAGAAC CGCCGCGTGT GGCAGCTCGA CAGGGAGATC AGGAGCCACC TCGCCAAGTT
CGTCACCGGC CTGCAGAGCT GCAGCAGCAG CCATGGCGAC GACGCCGATG ATGGCGGCGA TGGCGGCGGC GGCATGAGGG
AGTTCATGAG CTTCATGGCG CCGGCGATGA CGGCGGGCGA GATCATCGAG GAGAGCAAGA ACTTCTTCTT CGCCGGGAAG
GAGACGCTGT CCAACCTCCT CACCTGGACC ACCGTCGCGC TCGCCATGCA CCCGGAGTGG CAGGAACGTG CCCGCCGCGA
GGTCGTCGCC GTCTGCGGCC GTGGCGACCT CCCCACCAAG GACCACCTCC CCAAGCTCAA AACCGTATGT AATTCTTGCG
TCACACGATG TCGAATGTTC AGATAtactc catccgtttc atattataaa ttatttgatt tttttagtca aactttatta
agtttaatta aaattataga aaaatttaat aacatttaaa atattaaatt agtttcatta aatataacat cacatatatt
ttgataatat gtttattttg tattgaaaat attactatac ttttctataa acttgatcaa attcaaagaa atttgtgtag
aaaaaaatgt caaacgactt ataaaatgga acgtaaggag taAGGTgttt tgattatttt ttctagtcaa acttatttaa
gtttgattga gtttatatac aaaatttaga aatacttatg tcactaaatt agtttcatta aacgtaacat taaatatatt
ttgatgatat gttggtttta tgttgaaaat attgatatat ttttctataa gcttagtcaa actttaaaat aattggatta
aaaatcaaaa cgaGAGAGGG ATTACATTGC AACGATCCAT GAATTCTTGG TCGTCGTCTT CTCCTTGCAG CTCGGGATGA
TCTTGAACGA GACGCTGAGG CTGTACCCGC CGGCGGTGGC GATGATACGG ACGGCGAAGG AGGACGTGGA GCTGGGCGGG
TGCGTGGTGC CGGCGGGGAC GGAGGTGATG ATCCCGATCA TGGCCGTCCA CCACGACGCG GCGGCGTGGG GCGACGACGC
CGCGGAGTTC AACCCGGCGA GGTTCGCCGC CGACGACGAC GGCGGCCGGC GCCGCCACCC GATGGCGTTC ATGCCGTTCG
GCGGCGGCGC GCGGGTGTGC ATCGGCCAGA ACATGGCGCT CATGGAGGCC AAGGTGGCGC TCGCCGTCGT CCTGCGGCGC
TTCGAGTTCC GGCTATCGCC GGCGTACGTG CACGCGCCCA GGGTGCTCAT GATACTCAGC CCGCAGTTCG GCGCGCCGGT
GATCTTCCGG CCGCTGACGT CAGCCGCAGC TTAG

Locus: Os07g0647200

Loading...

Locus: Os07g0647200

Loading...