Os07t0658300-01

Locus

Os07g0658300

Description

Rho GTPase-activating protein, Target of the E3 ligase SPL11, Negative regulation of programmed cell death and innate immunity

RAP-DB Gene Symbol Synonym(s)

SPIN6, Spin6

RAP-DB Gene Name Synonym(s)

SPL11-interacting Protein 6, SPL11-interacting protein6

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

SPIN6, Spin6, SIP11

Oryzabase Gene Name Synonym(s)

SPL11-interacting Protein 6, SPL11-interacting protein6, SKIP interacting protein 11, SKIPa-interacting protein 11, SKIPa-interacting protein 11

Transcript Evidence

AK103870

Protein Evidence

Q0D3Z0

Literature

PMID: 25658451

Note

Manual Curation

March 4, 2016

Gene Ontology (GO)

Biological Process: signal transduction (GO:0007165)

Functional domain (InterPro)

PH domain-like (IPR011993)

Pleckstrin homology domain (IPR001849)

Rho GTPase activation protein (IPR008936)

Rho GTPase-activating protein domain (IPR000198)

Ternary complex factor MIP1, leucine-zipper (IPR025757)

Full-length cDNA

J033149H24 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0658300-01)

RiceXPro (AK103870)

Others

Oryzabase (20006)

KEGG (Os07t0658300-01)

Transcript

3124 bp

>Os07t0658300-01 Rho GTPase-activating protein, Target of the E3 ligase SPL11, Negative regulation of programmed cell death and innate immunity
ACGCGCCCACGCCCACCACCACCACCACCTCCATGACTGCATCCTCCTCCAAAAACCCAA
GGCACAAATCCTAACCACCGGACGCGAGCCGACGCGACGCGACGCGAGTCCCCATCCACA
TCGCTCGCGGCCCTTCCACCGCACGCCAGATCGGTGGCGGCGGCGGCTGCTCGGGGTTGG
ATCCAATGCGAGCGGTGATTGATAGCTGTTGATGCGAAGGACGACGATCTGAGGTGGTGG
TGGAGTTGGGGGGATGGCTGCGGCGACGGCGCCGGTGGCGGGTGCGGCGGAGCGGCAGCA
GCAACAGCAGCAGCAGCAGCGCGGCGGGGCGGCGTCGGCGAGCGGCAACGCGGTATTTAA
GAGTGGCCCTCTCTTCATATCATCCAAAGGAATTGGATGGAAATCATGGAAAAAGCGTTG
GTTCATCCTCACTCGAACATCACTTGTTTTCTTCAAGAGCGACCCTAATACCTTGCCCCA
GAGAGGTGGTGAAGTGAATGTTACTTTGGGGGGAATTGACTTGAACAATTCTGGGAGTGT
AGTGGTCAGGGAAGACAAGAAATTGTTAACTGTCCTTTTTCCAGATGGTCGTGACGGCCG
TGCTTTTACCTTGAAGGCAGAGACATCGGAAGATTTGTTTGAGTGGAAAACAGCATTGGA
AGAAGCTCTTGCACAGGCCCCAAATGCAGCTCTTGTGATGGGACATAATGGGATATTTCG
TAATGACACAACAGATCCATATGAAGGAGCTGTTCCAAACTGGCGAGAGAAGAGGCCTAT
CAAATCATTGGTTGTTGGTAGGCCGATTCTTCTTGCACTGGAAGATATTGATGGCAGCCC
TTCTTTCCTAGAAAAAGCTTTGCGTTTTCTTGAGAGACATGGAATAAAGGTGGAGGGAAT
TTTGCGCCAGGCTGCAGATGTGGAGGAGGTTGACAAAAGAATGCAAGAATATGAGCAAGG
AAGGACGGAGTTTGCACAGGATGAGGATGCTCATGTTATTGGTGACTGTGTAAAGCATGT
TCTACGTGAACTACCATCTTCTCCAGTACCTGCTTCCTGCTGCACAGCCTTATTGGAAGC
TTTTCGTCTGGAGAGCAAGGAATCTCGGATAAATTCTATGCGTGCGGCAATATCTGAGAC
ATTTCCTGAGCCTAATAGGCGGCTGCTACAGAGAATTTTGAGAATGATGCACACTGTTGC
TTCTCATACTGCTGAGAATCGAATGACTGCATCAGCAGTTGCTGCCTGTATGGCTCCTCT
CTTGTTGCGTCCACTTCTGGCTGGTGAGTGTGAGATGGAAGATGACTTGGACATGAATGG
TGACAGTTCTGCCCAGCTCATTGCTGCGGCAAATGCTGCCAACAGTGCTCAAGGCATTGT
CACTACTCTCTTGGAGGAATATGAGGGTATTTTTTATGATGAGCACCTGAGGTGTTCCCT
ATCACCTGATTCTCAAATTGAAGATAGCGGAAGTGAAGAGTCAACAGATGATGAAACTGT
GGATATCAAGGACAGTGGATTTCATGATGCAGAGAATGATGCAGATCAAGAATTAGATGA
CTCTGAGCGCATATTGAGTGGAAAATTAAGTGAAACCAGTGCATGCACTGCTGGTGACCT
CTATGACTACAAGGTAGCTGATGATGATTCAGACGGTGAACCTTCTACAGAAGATAAGGC
TTTGGAAACAAAGGTGGATGTAAATGATGCCCAGCATAGTCATTTAGCTGAAAATGTTTC
AGTGAATGTCCAGAGATCACCGAATGAAAAAGATCCACCAAATATGGTGTCCAGTCAGGA
TTCCCCGTTGTCGATGGGAGATATTCTTTCTTCTTTGGATGCTGGAATTTCCTTACCTGG
TCCTGGACCTGAATATTCTGTAGACAGGCAGTCCATCAAATCCAATGGAACTCAGATGCA
TGTGAAGCGCTCCAACTTTTGGGGACGGAACAATGGAAGAAAAAGTCAACAGTCAGAATT
GGCTGATTCATCGGGTGAAGAAGAGCTTGCTATCCAAAGACTGGAGATCACAAAGAATGA
CCTCCAGATCAGAATCGCGAAAGAGGCTAGAGGAAATGCAATCTTACAAGCAAGTTTGGA
AAGAAGAAAACAAGCACTACATGAGCGCCGTTTGGCTCTGGAGCAGGATGTTTCAAGGTT
GCAAGAGCAGCTACAAGCTGAAAGAGATCTTAGAGCTGCATTGGAGGTTGGATTAAGCAT
GTCTTCTGCACATATTTCTAGTTCACGTTCTATGGATTCAAAGACGAAGGCAGAGCTTGA
GGAGATTGCTCTTGCGGAGGCTGATGTTGCAAGGTTAAAGCAGAAGGTTGCGGAGCTCCA
TCTCCAACTCAACCAGCAGCGTCAACATCAGTATGGCTCTTTGGCAGATGCAAATGATCG
TTATCAACATCTTCCAAACCATCTCCCACAGAACTTTGTTCAATCAGGTTTTGATATGAA
CCTTGCTTTCTGTAATCAGGAGAAGAAGCAAAGGAATGAGGGCCCCGCAGGTGCATCGCA
TTGGAGAAGCATCAAGCAGCACGTGCTACCTCATGGTTCTTCAAGGCCCTTCTCCCGGAA
GCACTCCATGGACGCCTCGTCGAGTGATTCGAGGGAGGCATCAACGAGCATGCCAGCGGA
TGGCAATTCCATGTCCGTGAACATCCCGAAGGCAACCGAGGGCGTCGAGTACGGGAGGCA
AGCTCCCGTGGCATCGTCCACTCTGGTCGAACTGACGACCAGGCTAGATTTCTTCAAAGA
ACGGCGGTCACAATTAATGGAGCAACTCCACAGCCTGGATTTAGGAAATGGATCAGCTAA
TCATGGTTTCCCATACAAGTCTTCGTCACCTTGGAACAGTCCAAGGTAGGAGGAGACTTC
TTTTTTTTTGCGACATTCTGTTTGTATATTCTTGGTAAAGAATCCTCTCGTTTTCTTTCG
TAGAAGCTGCTAGTGAGAATGAATGTATATCCCTTTCCTGTTCGTCTTCCATTTGTTTTT
GTTTTGTTGTTGCATGCGGCAGCCTCTTTTGGGTGTGATTTTGTAATATGCTTTTTGTAA
TCTATTGTATGTAACACGAGTTGGGGGGATCATAATCATTGCCACTTGTTTCTGGTGTCT
TTCC

CDS

2616 bp

>Os07t0658300-01 Rho GTPase-activating protein, Target of the E3 ligase SPL11, Negative regulation of programmed cell death and innate immunity
ATGGCTGCGGCGACGGCGCCGGTGGCGGGTGCGGCGGAGCGGCAGCAGCAACAGCAGCAG
CAGCAGCGCGGCGGGGCGGCGTCGGCGAGCGGCAACGCGGTATTTAAGAGTGGCCCTCTC
TTCATATCATCCAAAGGAATTGGATGGAAATCATGGAAAAAGCGTTGGTTCATCCTCACT
CGAACATCACTTGTTTTCTTCAAGAGCGACCCTAATACCTTGCCCCAGAGAGGTGGTGAA
GTGAATGTTACTTTGGGGGGAATTGACTTGAACAATTCTGGGAGTGTAGTGGTCAGGGAA
GACAAGAAATTGTTAACTGTCCTTTTTCCAGATGGTCGTGACGGCCGTGCTTTTACCTTG
AAGGCAGAGACATCGGAAGATTTGTTTGAGTGGAAAACAGCATTGGAAGAAGCTCTTGCA
CAGGCCCCAAATGCAGCTCTTGTGATGGGACATAATGGGATATTTCGTAATGACACAACA
GATCCATATGAAGGAGCTGTTCCAAACTGGCGAGAGAAGAGGCCTATCAAATCATTGGTT
GTTGGTAGGCCGATTCTTCTTGCACTGGAAGATATTGATGGCAGCCCTTCTTTCCTAGAA
AAAGCTTTGCGTTTTCTTGAGAGACATGGAATAAAGGTGGAGGGAATTTTGCGCCAGGCT
GCAGATGTGGAGGAGGTTGACAAAAGAATGCAAGAATATGAGCAAGGAAGGACGGAGTTT
GCACAGGATGAGGATGCTCATGTTATTGGTGACTGTGTAAAGCATGTTCTACGTGAACTA
CCATCTTCTCCAGTACCTGCTTCCTGCTGCACAGCCTTATTGGAAGCTTTTCGTCTGGAG
AGCAAGGAATCTCGGATAAATTCTATGCGTGCGGCAATATCTGAGACATTTCCTGAGCCT
AATAGGCGGCTGCTACAGAGAATTTTGAGAATGATGCACACTGTTGCTTCTCATACTGCT
GAGAATCGAATGACTGCATCAGCAGTTGCTGCCTGTATGGCTCCTCTCTTGTTGCGTCCA
CTTCTGGCTGGTGAGTGTGAGATGGAAGATGACTTGGACATGAATGGTGACAGTTCTGCC
CAGCTCATTGCTGCGGCAAATGCTGCCAACAGTGCTCAAGGCATTGTCACTACTCTCTTG
GAGGAATATGAGGGTATTTTTTATGATGAGCACCTGAGGTGTTCCCTATCACCTGATTCT
CAAATTGAAGATAGCGGAAGTGAAGAGTCAACAGATGATGAAACTGTGGATATCAAGGAC
AGTGGATTTCATGATGCAGAGAATGATGCAGATCAAGAATTAGATGACTCTGAGCGCATA
TTGAGTGGAAAATTAAGTGAAACCAGTGCATGCACTGCTGGTGACCTCTATGACTACAAG
GTAGCTGATGATGATTCAGACGGTGAACCTTCTACAGAAGATAAGGCTTTGGAAACAAAG
GTGGATGTAAATGATGCCCAGCATAGTCATTTAGCTGAAAATGTTTCAGTGAATGTCCAG
AGATCACCGAATGAAAAAGATCCACCAAATATGGTGTCCAGTCAGGATTCCCCGTTGTCG
ATGGGAGATATTCTTTCTTCTTTGGATGCTGGAATTTCCTTACCTGGTCCTGGACCTGAA
TATTCTGTAGACAGGCAGTCCATCAAATCCAATGGAACTCAGATGCATGTGAAGCGCTCC
AACTTTTGGGGACGGAACAATGGAAGAAAAAGTCAACAGTCAGAATTGGCTGATTCATCG
GGTGAAGAAGAGCTTGCTATCCAAAGACTGGAGATCACAAAGAATGACCTCCAGATCAGA
ATCGCGAAAGAGGCTAGAGGAAATGCAATCTTACAAGCAAGTTTGGAAAGAAGAAAACAA
GCACTACATGAGCGCCGTTTGGCTCTGGAGCAGGATGTTTCAAGGTTGCAAGAGCAGCTA
CAAGCTGAAAGAGATCTTAGAGCTGCATTGGAGGTTGGATTAAGCATGTCTTCTGCACAT
ATTTCTAGTTCACGTTCTATGGATTCAAAGACGAAGGCAGAGCTTGAGGAGATTGCTCTT
GCGGAGGCTGATGTTGCAAGGTTAAAGCAGAAGGTTGCGGAGCTCCATCTCCAACTCAAC
CAGCAGCGTCAACATCAGTATGGCTCTTTGGCAGATGCAAATGATCGTTATCAACATCTT
CCAAACCATCTCCCACAGAACTTTGTTCAATCAGGTTTTGATATGAACCTTGCTTTCTGT
AATCAGGAGAAGAAGCAAAGGAATGAGGGCCCCGCAGGTGCATCGCATTGGAGAAGCATC
AAGCAGCACGTGCTACCTCATGGTTCTTCAAGGCCCTTCTCCCGGAAGCACTCCATGGAC
GCCTCGTCGAGTGATTCGAGGGAGGCATCAACGAGCATGCCAGCGGATGGCAATTCCATG
TCCGTGAACATCCCGAAGGCAACCGAGGGCGTCGAGTACGGGAGGCAAGCTCCCGTGGCA
TCGTCCACTCTGGTCGAACTGACGACCAGGCTAGATTTCTTCAAAGAACGGCGGTCACAA
TTAATGGAGCAACTCCACAGCCTGGATTTAGGAAATGGATCAGCTAATCATGGTTTCCCA
TACAAGTCTTCGTCACCTTGGAACAGTCCAAGGTAG

Protein

872 aa

>Os07t0658300-01 Rho GTPase-activating protein, Target of the E3 ligase SPL11, Negative regulation of programmed cell death and innate immunity
MAAATAPVAGAAERQQQQQQQQRGGAASASGNAVFKSGPLFISSKGIGWKSWKKRWFILT
RTSLVFFKSDPNTLPQRGGEVNVTLGGIDLNNSGSVVVREDKKLLTVLFPDGRDGRAFTL
KAETSEDLFEWKTALEEALAQAPNAALVMGHNGIFRNDTTDPYEGAVPNWREKRPIKSLV
VGRPILLALEDIDGSPSFLEKALRFLERHGIKVEGILRQAADVEEVDKRMQEYEQGRTEF
AQDEDAHVIGDCVKHVLRELPSSPVPASCCTALLEAFRLESKESRINSMRAAISETFPEP
NRRLLQRILRMMHTVASHTAENRMTASAVAACMAPLLLRPLLAGECEMEDDLDMNGDSSA
QLIAAANAANSAQGIVTTLLEEYEGIFYDEHLRCSLSPDSQIEDSGSEESTDDETVDIKD
SGFHDAENDADQELDDSERILSGKLSETSACTAGDLYDYKVADDDSDGEPSTEDKALETK
VDVNDAQHSHLAENVSVNVQRSPNEKDPPNMVSSQDSPLSMGDILSSLDAGISLPGPGPE
YSVDRQSIKSNGTQMHVKRSNFWGRNNGRKSQQSELADSSGEEELAIQRLEITKNDLQIR
IAKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRAALEVGLSMSSAH
ISSSRSMDSKTKAELEEIALAEADVARLKQKVAELHLQLNQQRQHQYGSLADANDRYQHL
PNHLPQNFVQSGFDMNLAFCNQEKKQRNEGPAGASHWRSIKQHVLPHGSSRPFSRKHSMD
ASSSDSREASTSMPADGNSMSVNIPKATEGVEYGRQAPVASSTLVELTTRLDFFKERRSQ
LMEQLHSLDLGNGSANHGFPYKSSSPWNSPR*

5'UTR

chr07:27713321..27713573 (+ strand) : 253 bp

CDS

chr07:27713574..27713672 (+ strand) : 99 bp

chr07:27714663..27714699 (+ strand) : 37 bp

chr07:27714783..27714859 (+ strand) : 77 bp

chr07:27715851..27715921 (+ strand) : 71 bp

chr07:27716091..27716169 (+ strand) : 79 bp

chr07:27716305..27716449 (+ strand) : 145 bp

chr07:27716542..27716661 (+ strand) : 120 bp

chr07:27716759..27716836 (+ strand) : 78 bp

chr07:27716995..27717050 (+ strand) : 56 bp

chr07:27717167..27717236 (+ strand) : 70 bp

chr07:27717758..27717845 (+ strand) : 88 bp

chr07:27718136..27718379 (+ strand) : 244 bp

chr07:27718522..27718737 (+ strand) : 216 bp

chr07:27719100..27719420 (+ strand) : 321 bp

chr07:27719633..27719682 (+ strand) : 50 bp

chr07:27720072..27720132 (+ strand) : 61 bp

chr07:27720212..27720295 (+ strand) : 84 bp

chr07:27720505..27720618 (+ strand) : 114 bp

chr07:27720713..27720879 (+ strand) : 167 bp

chr07:27721138..27721207 (+ strand) : 70 bp

chr07:27721907..27722086 (+ strand) : 180 bp

chr07:27722198..27722386 (+ strand) : 189 bp

3'UTR

chr07:27722387..27722641 (+ strand) : 255 bp

FASTA

>Os07t0658300-01 class=Sequence position=chr07:27713321..27722641 (+ strand)
ACGCGCCCAC GCCCACCACC ACCACCACCT CCATGACTGC ATCCTCCTCC AAAAACCCAA GGCACAAATC CTAACCACCG
GACGCGAGCC GACGCGACGC GACGCGAGTC CCCATCCACA TCGCTCGCGG CCCTTCCACC GCACGCCAGA TCGGTGGCGG
CGGCGGCTGC TCGGGGTTGG ATCCAATGCG AGCGGTGATT GATAGCTGTT GATGCGAAGG ACGACGATCT GAGGTGGTGG
TGGAGTTGGG GGGATGGCTG CGGCGACGGC GCCGGTGGCG GGTGCGGCGG AGCGGCAGCA GCAACAGCAG CAGCAGCAGC
GCGGCGGGGC GGCGTCGGCG AGCGGCAACG CGGTGAGTTT TGGGGTGGTC CCTTCGCCTT CTGCTCTCCG ATTCCTCGCT
TGCGCTTGGT GCCTCTCTTC GGTGGTGTGC TGTGGCTGTG TCTGTCTGCT GGATTTTCGT TCCGGTTTGG TATCTGATGC
TGCGTTGCCG CCGAGTTTCT CGCCGGAGTG GTGCTTTGCT TTGGCGTGTG GATGGATGGG TGTTCCACTG TTTTGGTGGT
GGTGGAATTT TTGGTTGAGC TGCAAGGCCA GATGGCGCGG ATAAGCCAAT GCAGTTTGGT TCGGTGGAGT TGGTGGTGTG
ATGAATGGGT TTCGTTTGAG AAAATCACCG TACTAAGCGA GGAGTGAGGT TGCAGTAGTT GCTAATGTTC CTGTTTTATT
TGGGTTTGGA TTGGATTTGG TGGTCTTAGT ATTGGAGGTG TTATCCAGAT GTTTTAGTCT GAGAGTGACC AGCGGATTGC
ATGGTGGATG ATACTTGGCT TGGATTAGAG TTGTTTACCA CAGGAATGCG AATCGAAATG TTTGAGAGAG TATCAATTTG
TCATGGCGTA AGGATGGAGG GATTCTACAG TGTCATCTGC ACGCTGAAAC TGGACATTGG ATGTGTGAGA TGCTTTGCAG
GCTGACTGGT GTTGGATCGT TGTGGTGCCC TGTGAATGAT GGGCTTCAGA TATGAGGTGC AGGGAGAGTG GGAATCCAGA
TGAGGGAAGT GAGGAATTTA CTGGAGTTTT TCCCCGTTGA ATTCATCTGT CCTTTTACGT TCATAGATGA ACAGTCTGTA
TATTCAGTGG TTATTTGGAG AGGCGTGGTT TGATTTGTTC ACTCTTGCTG GATCTCTGAT ACATAGGTCC CGAATTGCAT
GTCTGCTAGC CCGAGTACAA GACTTCTGAA TGTTCTCGTT AAAACAGAAC TTTCGATTGG GACCTGATGT TGCATTTTTT
TGCTATTACA TATTTACCAT TATAATCACA GTATTTCTGA CATTGTAATT CTCTCTAACT AGGTATTTAA GAGTGGCCCT
CTCTTCATAT CATCCAAAGG TAAACTATTT GGGTTATGCA TCAGTTATTT CCACCTGTGC ATATCAGAGC ATCACCATTA
ATTTTCAGCT ATGATTTTTA AGGAATTGGA TGGAAATCAT GGAAAAAGCG TTGGTTCATC CTCACTCGAA CATCACTTGT
TTTCTTCAAG AGCGACCCTG TAAGTATTTT ATTCTGGTCC ACAACCTAAG TAATTGCTAT ATTGAAAATC TCAAGTTATG
TAGACCCATC AGTCCAGAAA TAGTACTTTG GTTTGGCTTG TTGATATGAC GGTTCACACC TATCTAGTAT CTACATAGCA
CTTTCATCGT CTCTCTTGAT CATGGCCAAT ATGTAGTAGT GTGATATACA TTTGTTTTAT GTTGATTTCA TGACAATGCA
TGTGTAGATC ACAATTAAAC ATGAGTACAG TATTTTTAGA GTTTGGCACT GAATGGCAGA ATGACTAATT TGCTCTTTTC
AGTCCACCAA ATATATGAGT AGCATCATTA TATTTTGTAG CTTCCTTGTT CTGGTGGTTA CATGTGTTCC TTTGCTTCAA
ATATCCAACT GGCAGTGCTT GATCCTTGGT AACTGCTTAT TCATGTTCTT GTCCATGTTA CACGAGAGTC CAGGTAGGTG
TTTAGTGTAT CCACTATTTT AGTCATTGCA TGGTCATCAG AATTGGCATT CCGGGCCACA GGTTGCTGAT TATTATTTAG
TCTAGAACTG AAGGGAAGAG GGAGGAGGGG AGGGGAGAAG GAAATCTAAC CTTCATACCA AATGCTGCTG TATGCCAAAG
CAGCAGCAGT TGCTCATGGC CATATTAGAG GGAGGAAGGA AAATTCTGTT GGGGATGTTG GACTGATAGA GATGCGAAAT
GTGATCGTTG GGGCGCTGGG ACGCCTTGTG TAGCCCACTC AGCCCACCTT TTTTATTCTC CTTTATCTTT TTTCTCCAAC
TAGGGCCAAT GGGATCACTC AGTGCATTTG AAAAACACCA CCTCCCCATC AACTCACATT TCTAGTAATC TGCAACCCCA
TCCCTTGGCC CAGATTCCTG GTGACTACAG TCATTGCCAT ATATTTCGTT TCATTTATTG TCCAGCTTAT GAGCTACACC
AATAGAATTT GTTTCTTACT TCTTGACAAG TACCTTTCAT GCCATTGTAG AATACCTTGC CCCAGAGAGG TGGTGAAGTG
AATGTTACTT TGGGGGGAAT TGACTTGAAC AATTCTGGGA GGTTTGTATC TTTCATTATT ATTTATTTAT TTGCAGTTTT
ATTCAAAGTT TACTTTATTA GATTTTTATC AAATTTGCTG CATACTTCTT AGACAAATGA TTTAGGGCAC TGCTTCCTTT
TTGGTTTAAC TGCATAATAA TGTTAAACTA ACAATTTATC TCATTCACAG TGTAGTGGTC AGGGAAGACA AGAAATTGTT
AACTGTCCTT TTTCCAGATG GTCGTGACGG CCGTGCTTTT ACCTTGAAGG TATACAATTT CCCTTTAACT TTAACAGCTT
GACCCCTTAG AAAATACAAG ATGTTGAATT ATAAGTGTTG TGTTTTTTAA GTCTTTTAAA TGCCCTTCAA AGTTCACTAG
AAGTGCCTGC TATTCCCAAT ACAGGCAGAG ACATCGGAAG ATTTGTTTGA GTGGAAAACA GCATTGGAAG AAGCTCTTGC
ACAGGCCCCA AATGCAGCTC TTGTGATGGG ACATAATGGG ATATTTCGTA ATGACACAAC AGATCCATAT GAAGGAGCTG
TTCCAAACTG TTGGTTCCTC TTCTCTAGTC TGACTTAGTT CTATTTGTGA AGAATTCCCT ATCTATCTCC TTTTTTCATA
CATACCATCC TTTCTCTGCA GGGCGAGAGA AGAGGCCTAT CAAATCATTG GTTGTTGGTA GGCCGATTCT TCTTGCACTG
GAAGATATTG ATGGCAGCCC TTCTTTCCTA GAAAAAGCTT TGCGTTTTCT TGAGAGACAT GGTATGGATA ATCATTGTTC
GTTATCAGTT ATCAATGAAG TTCGAAAATG CCTGAACCCA TCCAAAAAAT TGTTTGGAAA TGTGAATATT TCTTTCAGGA
ATAAAGGTGG AGGGAATTTT GCGCCAGGCT GCAGATGTGG AGGAGGTTGA CAAAAGAATG CAAGAATATG AGCAAGGTAC
ATGTAGTTAC CATGCTTGTA ACTTCATATG TAGAATTGTG ATTTAATTGG TGGCATTTAT GGTTTGATAA TTTTGGTGCA
CCATTAAAGT TATTGGTGAC TGTTTACCAT CGTCCAATAA CTCAATTATT GCACTTTGTT CTGTTTCATT ATAGGAAGGA
CGGAGTTTGC ACAGGATGAG GATGCTCATG TTATTGGTGA CTGTGTAAAG GTGCCTTGAT TCCTGTTACC TTGATGCTCC
AAAAATTCCT ATATGTTGCA AGAGTTTTAA TATTTCATTT CCTGCTTGCA AAGTGTATTT ATGTAAAGTC AAAAACATTT
CTGCAGCATG TTCTACGTGA ACTACCATCT TCTCCAGTAC CTGCTTCCTG CTGCACAGCC TTATTGGAAG CTTTTCGTAA
GTGCTCTGCT TTGTTCATGT TAGCTTAAAT ATCGTCATTC ACGATCCTTG ATAAACTTTA TAATGAATTC AATAAAATAC
AAACAAATTC ACTAAACTAC CTAATATTAG AAGAAGCTGC AATATTTTTT AGTTACTAAA ACTAATCATA GATACAGCCG
ATGTAAGTTC TAAGCTTTGA CTGCTTTGCT TACCTGTAGG ATACACTCAT ACCCCTTCTG GTGTCTGTTA CCAAGTACTA
GATTATTTTA AGGAGCAAAC CTATACAGAT TCAAAATCAG ACTATAACCT TTTATGGAAG TTGATTAAAG TTATACACTT
ATACATACTA CAGTTCAACT GGTAGATAAT GACTGTAACA TACAATGCTA TTTTTTGAAA AAAAATATTT ACAGAAACTA
AAACAGTTAG TGTTACCATA TACTTTAGCT TAGGTTTTTG TAATTTGTTT ATTTTCAGTT ATTTGCTTCC ATATTTCGTT
CCTTGGCATT CTTTTCATTT CCTTCATACT TTTCCAGGTC TGGAGAGCAA GGAATCTCGG ATAAATTCTA TGCGTGCGGC
AATATCTGAG ACATTTCCTG AGCCTAATAG GCGGCTGCTA CAGAGGTCAG TGTACTTCTA TTTTATGTGG ATATCTTATC
TGCCGAGTTG GCTTTGCCTG CTGGCATATC AGCCTGAATA TTGCATTATC ACTAAAGCCT GATACCTTCT GAGATCAGGG
TTTTTGTCAA TGTTTTTGTA TTGATTAAAA TTATGTGTTT GATATAGGAG TAACAAAACA CATTCAGCTC TGTACTAATA
GTGTAAAAAT TGCTAGTGAT GTTATGTTAT CATTTAGATA GTTTATCAAC AACTGGCCAA ATTCTTAACA AGCTTGTAAA
ACCATTTTTT GGCAGAATTT TGAGAATGAT GCACACTGTT GCTTCTCATA CTGCTGAGAA TCGAATGACT GCATCAGCAG
TTGCTGCCTG TATGGCTCCT CTCTTGTTGC GTCCACTTCT GGCTGGTGAG TGTGAGATGG AAGATGACTT GGACATGAAT
GGTGACAGTT CTGCCCAGCT CATTGCTGCG GCAAATGCTG CCAACAGTGC TCAAGGCATT GTCACTACTC TCTTGGAGGA
ATATGAGGGT ATTTTTTATG TAAGTTTACT CGATACCATC CCAGAGAATG TTGCCCTGAT GATTCTTTTC TGGCAATATT
AATCTAATCC TTGATTGATT GTTTTTCTAT TTATTGTGGA AGTTACTAAT TTTTAATTAT TCATGTTTAT CAATTTTACA
GGATGAGCAC CTGAGGTGTT CCCTATCACC TGATTCTCAA ATTGAAGATA GCGGAAGTGA AGAGTCAACA GATGATGAAA
CTGTGGATAT CAAGGACAGT GGATTTCATG ATGCAGAGAA TGATGCAGAT CAAGAATTAG ATGACTCTGA GCGCATATTG
AGTGGAAAAT TAAGTGAAAC CAGTGCATGC ACTGCTGGTG ACCTCTATGA CTACAAGGTT TGGTGTTTGC AGTCTTAAAA
TTTTTAATCG GTAGTAAGTT TGATCTAATA CAATCATATA TACAGTTCGA ATATTTTCAA GTCAATCATA TATACACGGA
AAAAGGTTTA AGATTCCAAT TCCACTGATG AGAAGTTTTT TTTCTTCCCT TTGCACATGC AGTAGTTCTT TTCACTATAT
AGTAGCATAA TCTTATCGCG CCTATCCTTA CATATTTTTG GTGGTTCATG ATATGAAGCA TTCTGAGTAG CTTAATCAGA
AACCAACTTG GCTTTTAATT TTTATTTGAT TAGCAAGTTC ATCTGTCAAA AATCATGATG TGGCTTATGC TTTTGTTCTC
ATTGCAACAT GAACGACAGG TAGCTGATGA TGATTCAGAC GGTGAACCTT CTACAGAAGA TAAGGCTTTG GAAACAAAGG
TGGATGTAAA TGATGCCCAG CATAGTCATT TAGCTGAAAA TGTTTCAGTG AATGTCCAGA GATCACCGAA TGAAAAAGAT
CCACCAAATA TGGTGTCCAG TCAGGATTCC CCGTTGTCGA TGGGAGATAT TCTTTCTTCT TTGGATGCTG GAATTTCCTT
ACCTGGTCCT GGACCTGAAT ATTCTGTAGA CAGGCAGTCC ATCAAATCCA ATGGAACTCA GATGCATGTG AAGCGCTCCA
ACTTTTGGGG ACGGAACAAT GTAAGTGAGA ACTTTTGTCC TTTACTGTAT CTCCTCAGAA AGTTCATGTT ACTTGAAGGG
AAGTAGAATT GTGACCACTG ACTTATGGTT CTGTGATATT CTTTAAAGAA CATTATGGTT TCCTCTGGGA AAACATTAGG
AGATATGCAC TCCTTAGGAC ACTATCAGTG TATAAAGTTG TTTCAAGTGA TTTACACATT CGGTTTATGC AGGGAAGAAA
AAGTCAACAG TCAGAATTGG CTGATTCATC GGGTGAAGAA GAGTAAGTCC CCATTCCATT TTCGTGTTTA AATGATTGTT
TCATGTAAAA GGATAGAGTT GAAGAGTTAG TTATTCTTGA AGTTGTTCCA TCAATACATT TGCTTCTGGT GTTCTGCCTG
CTGGATCATT TTTCTGTTAC TAGTTAAGTT GGAGATACAT CCATTCAGGT AAAATATGTA GCAACAGCTT TCTATGATAA
CCATTGTTTA GACCTATTGA GAAGTTGTTT CTGTGCTAGC CTTTTGGCTA GTGCTACCAT TGACTGGTAA TGATAGGACT
GAGCATTATT GTTTTGTAGC CTTAAAACTT CTCATTGAAT AATTGTATCA AAATAGCAGT GTGATGGATT GATTTAATGT
TAATTACTCT TAACTGTTAA ATTTCTTTCA GGCTTGCTAT CCAAAGACTG GAGATCACAA AGAATGACCT CCAGATCAGA
ATCGCGAAAG AGGTACAAAG GGAATAGTAC ATGTATACTC AAGACTTTTG ATTTACAGTA ATACTAAAAA CTAATTGGAA
ATGCTTCTCA GGCTAGAGGA AATGCAATCT TACAAGCAAG TTTGGAAAGA AGAAAACAAG CACTACATGA GCGCCGTTTG
GCTCTGGAGC AGGATGTATG CTATATTCTT TTACCCTATG AATTAGTTAT TTCATTCCAT GCTTCCAAAA TATGCTGAAA
ATTTCACCAT CTGTAGTAAC AGTTTCAATC AACTTTTATG TTGTATGTTT TATTGAACAA TTCACTGTCA GGCTTTTAAA
TACAAACACG TGGACTTTAA GACAGTTTCT TACTTTGTTT GATGGCAACT GCTTGTACCT CTAGGTTTCA AGGTTGCAAG
AGCAGCTACA AGCTGAAAGA GATCTTAGAG CTGCATTGGA GGTTGGATTA AGCATGTCTT CTGCACATAT TTCTAGTTCA
CGTTCTATGG ATTCAAAGGT ACTCAAATGT TATGCAACTT GACACTGATG ATCATATATA CTCTGTGGGC TTATTGATGG
AATCTAATTT CTTCTTTGTG CTTCCCTTAA AGACGAAGGC AGAGCTTGAG GAGATTGCTC TTGCGGAGGC TGATGTTGCA
AGGTTAAAGC AGAAGGTTGC GGAGCTCCAT CTCCAACTCA ACCAGCAGCG TCAACATCAG TATGGCTCTT TGGCAGATGC
AAATGATCGT TATCAACATC TTCCAAACCA TCTCCCACAG TAAGAAACCA TATTTTTCAT AGTTAACATT CATTTCAATT
TTGTTTGAAC TGTGGTCCAG ACTCCAGAAC ATCCATAAAT ATCAAGTATT GGCTGCTACA CATTTTAGTA ACAAAAACAT
GATGTTTCTG CTGTCAACTG CTGGCTTACT ATATCTGCTC AAACCATATA TGTTTAACAG TTCAATGTGT TATATATACT
CTAGTTGTCC TTTGAAATTG CAATACATTA ACTATGCGAA TATTTTGTTG CCAACAGGAA CTTTGTTCAA TCAGGTTTTG
ATATGAACCT TGCTTTCTGT AATCAGGAGA AGAAGCAAAG GAATGAGGTT AGCTAAAGAT TTTCCCTTAA TCTTCTATGC
TTAAATTTAC GACAACAGAA GTTGGAAAAT ACAGAACCAA CCAATTAGCT GATGTTAGCT CATTTTCTCA TTGCGCTATC
ATTATGGTGT GCTTAAGGTG TAAAATGCCC CAATTATTTT TTGTGCTATA TTTCCAACCT TTCCATATGG TTGACTGTGC
TCATCCAATG TTTCAATTGC TAGGTATAGC TCGAATGATA CAAACTCCTA GTAGATTATG CCAAAATTTA ATATCCATGC
ATCACAATTG TTTGGCCCAA CCAtagtcac aggaaacggc ggtggcagcg atcctcgacc cgggaacgcc gtccctgtcc
cgaaaacacg gggtcatttt cgtccccacc ttgtaaaaac ctctcgcaag tagcgtatca cgttcctcga tcccgttcct
cgatcccatt gacccaggaa ctttgtgact atggGCCCAA CCACCAATTT ATACCCCCAA AGCCATCCAG GTCAGGTGGG
TCAAACAACC ACTTAAGGGG GACGTTCGCC CACTAGCCTT CTCTCGTTGC ACCTCTAGTT CTCAGCGTCT TATGGGCCTG
CAGGTTTATA GAAAAGCAAA GGCACCGATG AGTAATTGTC TACTTGCAAT GTAAAAAAAT CCCATTTCGT CCACTGATGG
CACAACAACG TTCTGTGTGA CAGCAGGGCC CCGCAGGTGC ATCGCATTGG AGAAGCATCA AGCAGCACGT GCTACCTCAT
GGTTCTTCAA GGCCCTTCTC CCGGAAGCAC TCCATGGACG CCTCGTCGAG TGATTCGAGG GAGGCATCAA CGAGCATGCC
AGCGGATGGC AATTCCATGT CCGTGAACAT CCCGAAGGCA ACCGAGGTAA AGGAAAAACC ACTGCTTCCG AACTGAAGGG
TGCGGTAGTG TCGAAATAAA GACCACACCG CTTCTCATTC AATACGAGTA TTCAATTCTC TTGTATCACT ATCACAGGGC
GTCGAGTACG GGAGGCAAGC TCCCGTGGCA TCGTCCACTC TGGTCGAACT GACGACCAGG CTAGATTTCT TCAAAGAACG
GCGGTCACAA TTAATGGAGC AACTCCACAG CCTGGATTTA GGAAATGGAT CAGCTAATCA TGGTTTCCCA TACAAGTCTT
CGTCACCTTG GAACAGTCCA AGGTAGGAGG AGACTTCTTT TTTTTTGCGA CATTCTGTTT GTATATTCTT GGTAAAGAAT
CCTCTCGTTT TCTTTCGTAG AAGCTGCTAG TGAGAATGAA TGTATATCCC TTTCCTGTTC GTCTTCCATT TGTTTTTGTT
TTGTTGTTGC ATGCGGCAGC CTCTTTTGGG TGTGATTTTG TAATATGCTT TTTGTAATCT ATTGTATGTA ACACGAGTTG
GGGGGATCAT AATCATTGCC ACTTGTTTCT GGTGTCTTTC C