Os07t0658300-02

Locus

Os07g0658300

Description

Splicing isoform of SPIN6

RAP-DB Gene Symbol Synonym(s)

Spin6.3, SPIN6.3

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

SPIN6, Spin6, SIP11

Oryzabase Gene Name Synonym(s)

SPL11-interacting Protein 6, SPL11-interacting protein6, SKIP interacting protein 11, SKIPa-interacting protein 11, SKIPa-interacting protein 11

Transcript Evidence

AK064580

Protein Evidence

Inferred from literature

Literature

PMID: 25658451

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

March 4, 2016

Gene Ontology (GO)

Biological Process: signal transduction (GO:0007165)

Functional domain (InterPro)

Rho GTPase activation protein (IPR008936)

Rho GTPase-activating protein domain (IPR000198)

Ternary complex factor MIP1, leucine-zipper (IPR025757)

Full-length cDNA

002-112-F01 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0658300-02)

Others

Oryzabase (20006)

KEGG (Os07t0658300-02)

Transcript

1592 bp

>Os07t0658300-02 Splicing isoform of SPIN6
CTGGAGAGCAAGGAATCTCGGATAAATTCTATGCGTGCGGCAATATCTGAGACATTTCCT
GAGCCTAATAGGCGGCTGCTACAGAGAATTTTGAGAATGATGCACACTGTTGCTTCTCAT
ACTGCTGAGAATCGAATGACTGCATCAGCAGTTGCTGCCTGTATGGCTCCTCTCTTGTTG
CGTCCACTTCTGGCTGGTGAGTGTGAGATGGAAGATGACTTGGACATGAATGGTGACAGT
TCTGCCCAGCTCATTGCTGCGGCAAATGCTGCCAACAGTGCTCAAGGCATTGTCACTACT
CTCTTGGAGGAATATGAGGGTATTTTTTATGATGAGCACCTGAGGTGTTCCCTATCACCT
GATTCTCAAATTGAAGATAGCGGAAGTGAAGAGTCAACAGATGATGAAACTGTGGATATC
AAGGACAGTGGATTTCATGATGCAGAGAATGATGCAGATCAAGAATTAGATGACTCTGAG
CGCATATTGAGTGGAAAATTAAGTGAAACCAGTGCATGCACTGCTGGTGACCTCTATGAC
TACAAGGTAGCTGATGATGATTCAGACGGTGAACCTTCTACAGAAGATAAGGCTTTGGAA
ACAAAGGTGGATGTAAATGATGCCCAGCATAGTCATTTAGCTGAAAATGTTTCAGTGAAT
GTCCAGAGATCACCGAATGAAAAAGATCCACCAAATATGGTGTCCAGTCAGGATTCCCCG
TTGTCGATGGGAGATATTCTTTCTTCTTTGGATGCTGGAATTTCCTTACCTGGTCCTGGA
CCTGAATATTCTGTAGACAGGCAGTCCATCAAATCCAATGGAACTCAGATGCATGTGAAG
CGCTCCAACTTTTGGGGACGGAACAATGGAAGAAAAAGTCAACAGTCAGAATTGGCTGAT
TCATCGGGTGAAGAAGAGCTTGCTATCCAAAGACTGGAGATCACAAAGAATGACCTCCAG
ATCAGAATCGCGAAAGAGGCTAGAGGAAATGCAATCTTACAAGCAAGTTTGGAAAGAAGA
AAACAAGCACTACATGAGCGCCGTTTGGCTCTGGAGCAGGATGTTTCAAGGTTGCAAGAG
CAGCTACAAGCTGAAAGAGATCTTAGAGCTGCATTGGAGGTTGGATTAAGCATGTCTTCT
GCACATATTTCTAGTTCACGTTCTATGGATTCAAAGACGAAGGCAGAGCTTGAGGAGATT
GCTCTTGCGGAGGCTGATGTTGCAAGGTTAAAGCAGAAGGTTGCGGAGCTCCATCTCCAA
CTCAACCAGCAGCGTCAACATCAGTATGGCTCTTTGGCAGATGCAAATGATCGTTATCAA
CATCTTCCAAACCATCTCCCACAGAACTTTGTTCAATCAGGTTTTGATATGAACCTTGCT
TTCTGTAATCAGGAGAAGAAGCAAAGGAATGAGGTTAGCTAAAGATTTTCCCTTAATCTT
CTATGCTTAAATTTACGACAACAGAAGTTGGAAAATACAGAACCAACCAATTAGCTGATG
TTAGCTCATTTTCTCATTGCGCTATCATTATGGTGTGCTTAAGGTGTAAAATGCCCCAAT
TATTTTTTGTGCTATATTTCCAACCTTTCCAT

CDS

1392 bp

>Os07t0658300-02 Splicing isoform of SPIN6
ATGCGTGCGGCAATATCTGAGACATTTCCTGAGCCTAATAGGCGGCTGCTACAGAGAATT
TTGAGAATGATGCACACTGTTGCTTCTCATACTGCTGAGAATCGAATGACTGCATCAGCA
GTTGCTGCCTGTATGGCTCCTCTCTTGTTGCGTCCACTTCTGGCTGGTGAGTGTGAGATG
GAAGATGACTTGGACATGAATGGTGACAGTTCTGCCCAGCTCATTGCTGCGGCAAATGCT
GCCAACAGTGCTCAAGGCATTGTCACTACTCTCTTGGAGGAATATGAGGGTATTTTTTAT
GATGAGCACCTGAGGTGTTCCCTATCACCTGATTCTCAAATTGAAGATAGCGGAAGTGAA
GAGTCAACAGATGATGAAACTGTGGATATCAAGGACAGTGGATTTCATGATGCAGAGAAT
GATGCAGATCAAGAATTAGATGACTCTGAGCGCATATTGAGTGGAAAATTAAGTGAAACC
AGTGCATGCACTGCTGGTGACCTCTATGACTACAAGGTAGCTGATGATGATTCAGACGGT
GAACCTTCTACAGAAGATAAGGCTTTGGAAACAAAGGTGGATGTAAATGATGCCCAGCAT
AGTCATTTAGCTGAAAATGTTTCAGTGAATGTCCAGAGATCACCGAATGAAAAAGATCCA
CCAAATATGGTGTCCAGTCAGGATTCCCCGTTGTCGATGGGAGATATTCTTTCTTCTTTG
GATGCTGGAATTTCCTTACCTGGTCCTGGACCTGAATATTCTGTAGACAGGCAGTCCATC
AAATCCAATGGAACTCAGATGCATGTGAAGCGCTCCAACTTTTGGGGACGGAACAATGGA
AGAAAAAGTCAACAGTCAGAATTGGCTGATTCATCGGGTGAAGAAGAGCTTGCTATCCAA
AGACTGGAGATCACAAAGAATGACCTCCAGATCAGAATCGCGAAAGAGGCTAGAGGAAAT
GCAATCTTACAAGCAAGTTTGGAAAGAAGAAAACAAGCACTACATGAGCGCCGTTTGGCT
CTGGAGCAGGATGTTTCAAGGTTGCAAGAGCAGCTACAAGCTGAAAGAGATCTTAGAGCT
GCATTGGAGGTTGGATTAAGCATGTCTTCTGCACATATTTCTAGTTCACGTTCTATGGAT
TCAAAGACGAAGGCAGAGCTTGAGGAGATTGCTCTTGCGGAGGCTGATGTTGCAAGGTTA
AAGCAGAAGGTTGCGGAGCTCCATCTCCAACTCAACCAGCAGCGTCAACATCAGTATGGC
TCTTTGGCAGATGCAAATGATCGTTATCAACATCTTCCAAACCATCTCCCACAGAACTTT
GTTCAATCAGGTTTTGATATGAACCTTGCTTTCTGTAATCAGGAGAAGAAGCAAAGGAAT
GAGGTTAGCTAA

Protein

464 aa

>Os07t0658300-02 Splicing isoform of SPIN6
MRAAISETFPEPNRRLLQRILRMMHTVASHTAENRMTASAVAACMAPLLLRPLLAGECEM
EDDLDMNGDSSAQLIAAANAANSAQGIVTTLLEEYEGIFYDEHLRCSLSPDSQIEDSGSE
ESTDDETVDIKDSGFHDAENDADQELDDSERILSGKLSETSACTAGDLYDYKVADDDSDG
EPSTEDKALETKVDVNDAQHSHLAENVSVNVQRSPNEKDPPNMVSSQDSPLSMGDILSSL
DAGISLPGPGPEYSVDRQSIKSNGTQMHVKRSNFWGRNNGRKSQQSELADSSGEEELAIQ
RLEITKNDLQIRIAKEARGNAILQASLERRKQALHERRLALEQDVSRLQEQLQAERDLRA
ALEVGLSMSSAHISSSRSMDSKTKAELEEIALAEADVARLKQKVAELHLQLNQQRQHQYG
SLADANDRYQHLPNHLPQNFVQSGFDMNLAFCNQEKKQRNEVS*

5'UTR

chr07:27717760..27717789 (+ strand) : 30 bp

CDS

chr07:27717790..27717845 (+ strand) : 56 bp

chr07:27718136..27718379 (+ strand) : 244 bp

chr07:27718522..27718737 (+ strand) : 216 bp

chr07:27719100..27719420 (+ strand) : 321 bp

chr07:27719633..27719682 (+ strand) : 50 bp

chr07:27720072..27720132 (+ strand) : 61 bp

chr07:27720212..27720295 (+ strand) : 84 bp

chr07:27720505..27720618 (+ strand) : 114 bp

chr07:27720713..27720879 (+ strand) : 167 bp

chr07:27721138..27721216 (+ strand) : 79 bp

3'UTR

chr07:27721217..27721386 (+ strand) : 170 bp

FASTA

>Os07t0658300-02 class=Sequence position=chr07:27717760..27721386 (+ strand)
CTGGAGAGCA AGGAATCTCG GATAAATTCT ATGCGTGCGG CAATATCTGA GACATTTCCT GAGCCTAATA GGCGGCTGCT
ACAGAGGTCA GTGTACTTCT ATTTTATGTG GATATCTTAT CTGCCGAGTT GGCTTTGCCT GCTGGCATAT CAGCCTGAAT
ATTGCATTAT CACTAAAGCC TGATACCTTC TGAGATCAGG GTTTTTGTCA ATGTTTTTGT ATTGATTAAA ATTATGTGTT
TGATATAGGA GTAACAAAAC ACATTCAGCT CTGTACTAAT AGTGTAAAAA TTGCTAGTGA TGTTATGTTA TCATTTAGAT
AGTTTATCAA CAACTGGCCA AATTCTTAAC AAGCTTGTAA AACCATTTTT TGGCAGAATT TTGAGAATGA TGCACACTGT
TGCTTCTCAT ACTGCTGAGA ATCGAATGAC TGCATCAGCA GTTGCTGCCT GTATGGCTCC TCTCTTGTTG CGTCCACTTC
TGGCTGGTGA GTGTGAGATG GAAGATGACT TGGACATGAA TGGTGACAGT TCTGCCCAGC TCATTGCTGC GGCAAATGCT
GCCAACAGTG CTCAAGGCAT TGTCACTACT CTCTTGGAGG AATATGAGGG TATTTTTTAT GTAAGTTTAC TCGATACCAT
CCCAGAGAAT GTTGCCCTGA TGATTCTTTT CTGGCAATAT TAATCTAATC CTTGATTGAT TGTTTTTCTA TTTATTGTGG
AAGTTACTAA TTTTTAATTA TTCATGTTTA TCAATTTTAC AGGATGAGCA CCTGAGGTGT TCCCTATCAC CTGATTCTCA
AATTGAAGAT AGCGGAAGTG AAGAGTCAAC AGATGATGAA ACTGTGGATA TCAAGGACAG TGGATTTCAT GATGCAGAGA
ATGATGCAGA TCAAGAATTA GATGACTCTG AGCGCATATT GAGTGGAAAA TTAAGTGAAA CCAGTGCATG CACTGCTGGT
GACCTCTATG ACTACAAGGT TTGGTGTTTG CAGTCTTAAA ATTTTTAATC GGTAGTAAGT TTGATCTAAT ACAATCATAT
ATACAGTTCG AATATTTTCA AGTCAATCAT ATATACACGG AAAAAGGTTT AAGATTCCAA TTCCACTGAT GAGAAGTTTT
TTTTCTTCCC TTTGCACATG CAGTAGTTCT TTTCACTATA TAGTAGCATA ATCTTATCGC GCCTATCCTT ACATATTTTT
GGTGGTTCAT GATATGAAGC ATTCTGAGTA GCTTAATCAG AAACCAACTT GGCTTTTAAT TTTTATTTGA TTAGCAAGTT
CATCTGTCAA AAATCATGAT GTGGCTTATG CTTTTGTTCT CATTGCAACA TGAACGACAG GTAGCTGATG ATGATTCAGA
CGGTGAACCT TCTACAGAAG ATAAGGCTTT GGAAACAAAG GTGGATGTAA ATGATGCCCA GCATAGTCAT TTAGCTGAAA
ATGTTTCAGT GAATGTCCAG AGATCACCGA ATGAAAAAGA TCCACCAAAT ATGGTGTCCA GTCAGGATTC CCCGTTGTCG
ATGGGAGATA TTCTTTCTTC TTTGGATGCT GGAATTTCCT TACCTGGTCC TGGACCTGAA TATTCTGTAG ACAGGCAGTC
CATCAAATCC AATGGAACTC AGATGCATGT GAAGCGCTCC AACTTTTGGG GACGGAACAA TGTAAGTGAG AACTTTTGTC
CTTTACTGTA TCTCCTCAGA AAGTTCATGT TACTTGAAGG GAAGTAGAAT TGTGACCACT GACTTATGGT TCTGTGATAT
TCTTTAAAGA ACATTATGGT TTCCTCTGGG AAAACATTAG GAGATATGCA CTCCTTAGGA CACTATCAGT GTATAAAGTT
GTTTCAAGTG ATTTACACAT TCGGTTTATG CAGGGAAGAA AAAGTCAACA GTCAGAATTG GCTGATTCAT CGGGTGAAGA
AGAGTAAGTC CCCATTCCAT TTTCGTGTTT AAATGATTGT TTCATGTAAA AGGATAGAGT TGAAGAGTTA GTTATTCTTG
AAGTTGTTCC ATCAATACAT TTGCTTCTGG TGTTCTGCCT GCTGGATCAT TTTTCTGTTA CTAGTTAAGT TGGAGATACA
TCCATTCAGG TAAAATATGT AGCAACAGCT TTCTATGATA ACCATTGTTT AGACCTATTG AGAAGTTGTT TCTGTGCTAG
CCTTTTGGCT AGTGCTACCA TTGACTGGTA ATGATAGGAC TGAGCATTAT TGTTTTGTAG CCTTAAAACT TCTCATTGAA
TAATTGTATC AAAATAGCAG TGTGATGGAT TGATTTAATG TTAATTACTC TTAACTGTTA AATTTCTTTC AGGCTTGCTA
TCCAAAGACT GGAGATCACA AAGAATGACC TCCAGATCAG AATCGCGAAA GAGGTACAAA GGGAATAGTA CATGTATACT
CAAGACTTTT GATTTACAGT AATACTAAAA ACTAATTGGA AATGCTTCTC AGGCTAGAGG AAATGCAATC TTACAAGCAA
GTTTGGAAAG AAGAAAACAA GCACTACATG AGCGCCGTTT GGCTCTGGAG CAGGATGTAT GCTATATTCT TTTACCCTAT
GAATTAGTTA TTTCATTCCA TGCTTCCAAA ATATGCTGAA AATTTCACCA TCTGTAGTAA CAGTTTCAAT CAACTTTTAT
GTTGTATGTT TTATTGAACA ATTCACTGTC AGGCTTTTAA ATACAAACAC GTGGACTTTA AGACAGTTTC TTACTTTGTT
TGATGGCAAC TGCTTGTACC TCTAGGTTTC AAGGTTGCAA GAGCAGCTAC AAGCTGAAAG AGATCTTAGA GCTGCATTGG
AGGTTGGATT AAGCATGTCT TCTGCACATA TTTCTAGTTC ACGTTCTATG GATTCAAAGG TACTCAAATG TTATGCAACT
TGACACTGAT GATCATATAT ACTCTGTGGG CTTATTGATG GAATCTAATT TCTTCTTTGT GCTTCCCTTA AAGACGAAGG
CAGAGCTTGA GGAGATTGCT CTTGCGGAGG CTGATGTTGC AAGGTTAAAG CAGAAGGTTG CGGAGCTCCA TCTCCAACTC
AACCAGCAGC GTCAACATCA GTATGGCTCT TTGGCAGATG CAAATGATCG TTATCAACAT CTTCCAAACC ATCTCCCACA
GTAAGAAACC ATATTTTTCA TAGTTAACAT TCATTTCAAT TTTGTTTGAA CTGTGGTCCA GACTCCAGAA CATCCATAAA
TATCAAGTAT TGGCTGCTAC ACATTTTAGT AACAAAAACA TGATGTTTCT GCTGTCAACT GCTGGCTTAC TATATCTGCT
CAAACCATAT ATGTTTAACA GTTCAATGTG TTATATATAC TCTAGTTGTC CTTTGAAATT GCAATACATT AACTATGCGA
ATATTTTGTT GCCAACAGGA ACTTTGTTCA ATCAGGTTTT GATATGAACC TTGCTTTCTG TAATCAGGAG AAGAAGCAAA
GGAATGAGGT TAGCTAAAGA TTTTCCCTTA ATCTTCTATG CTTAAATTTA CGACAACAGA AGTTGGAAAA TACAGAACCA
ACCAATTAGC TGATGTTAGC TCATTTTCTC ATTGCGCTAT CATTATGGTG TGCTTAAGGT GTAAAATGCC CCAATTATTT
TTTGTGCTAT ATTTCCAACC TTTCCAT