Os07t0658300-03

Locus

Os07g0658300

Description

Splicing isoform of SPIN6

RAP-DB Gene Symbol Synonym(s)

Spin6.2, SPIN6.2

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

SPIN6, Spin6, SIP11

Oryzabase Gene Name Synonym(s)

SPL11-interacting Protein 6, SPL11-interacting protein6, SKIP interacting protein 11, SKIPa-interacting protein 11, SKIPa-interacting protein 11

Transcript Evidence

AK058967

Protein Evidence

Inferred from literature

Literature

PMID: 25658451

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

March 4, 2016

Functional domain (InterPro)

Ternary complex factor MIP1, leucine-zipper (IPR025757)

Full-length cDNA

001-020-C09 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0658300-03)

Others

Oryzabase (20006)

KEGG (Os07t0658300-03)

Transcript

1728 bp

>Os07t0658300-03 Splicing isoform of SPIN6
GATGAGCACCTGAGGTGTTCCCTATCACCTGATTCTCAAATTGAAGATAGCGGAAGTGAA
GAGTCAACAGATGATGAAACTGTGGATATCAAGGACAGTGGATTTCATGATGCAGAGAAT
GATGCAGATCAAGAATTAGATGACTCTGAGCGCATATTGAGTGGAAAATTAAGTGAAACC
AGTGCATGCACTGCTGGTGACCTCTATGACTACAAGGTAGCTGATGATGATTCAGACGGT
GAACCTTCTACAGAAGATAAGGCTTTGGAAACAAAGGTGGATGTAAATGATGCCCAGCAT
AGTCATTTAGCTGAAAATGTTTCAGTGAATGTCCAGAGATCACCGAATGAAAAAGATCCA
CCAAATATGGTGTCCAGTCAGGATTCCCCGTTGTCGATGGGAGATATTCTTTCTTCTTTG
GATGCTGGAATTTCCTTACCTGGTCCTGGACCTGAATATTCTGTAGACAGGCAGTCCATC
AAATCCAATGGAACTCAGATGCATGTGAAGCGCTCCAACTTTTGGGGACGGAACAATGGA
AGAAAAAGTCAACAGTCAGAATTGGCTGATTCATCGGGTGAAGAAGAGCTTGCTATCCAA
AGACTGGAGATCACAAAGAATGACCTCCAGATCAGAATCGCGAAAGAGGCTAGAGGAAAT
GCAATCTTACAAGCAAGTTTGGAAAGAAGAAAACAAGCACTACATGAGCGCCGTTTGGCT
CTGGAGCAGGATGTTTCAAGGTTGCAAGAGCAGCTACAAGCTGAAAGAGATCTTAGAGCT
GCATTGGAGGTTGGATTAAGCATGTCTTCTGCACATATTTCTAGTTCACGTTCTATGGAT
TCAAAGACGAAGGCAGAGCTTGAGGAGATTGCTCTTGCGGAGGCTGATGTTGCAAGGTTA
AAGCAGAAGGTTGCGGAGCTCCATCTCCAACTCAACCAGCAGCGTCAACATCAGTATGGC
TCTTTGGCAGATGCAAATGATCGTTATCAACATCTTCCAAACCATCTCCCACAGAACTTT
GTTCAATCAGGTTTTGATATGAACCTTGCTTTCTGTAATCAGGAGAAGAAGCAAAGGAAT
GAGCAGGGCCCCGCAGGTGCATCGCATTGGAGAAGCATCAAGCAGCACGTGCTACCTCAT
GGTTCTTCAAGGCCCTTCTCCCGGAAGCACTCCATGGACGCCTCGTCGAGTGATTCGAGG
GAGGCATCAACGAGCATGCCAGCGGATGGCAATTCCATGTCCGTGAACATCCCGAAGGCA
ACCGAGGGCGTCGAGTACGGGAGGCAAGCTCCCGTGGCATCGTCCACTCTGGTCGAACTG
ACGACCAGGCTAGATTTCTTCAAAGAACGGCGGTCACAATTAATGGAGCAACTCCACAGC
CTGGATTTAGGAAATGGATCAGCTAATCATGGTTTCCCATACAAGTCTTCGTCACCTTGG
AACAGTCCAAGGTAGGAGGAGACTTCTTTTTTTTTGCGACATTCTGTTTGTATATTCTTG
GTAAAGAATCCTCTCGTTTTCTTTCGTAGAAGCTGCTAGTGAGAATGAATGTATATCCCT
TTCCTGTTCGTCTTCCATTTGTTTTTGTTTTGTTGTTGCATGCGGCAGCCTCTTTTGGGT
GTGATTTTGTAATATGCTTTTTGTAATCTATTGTATGTAACACGAGTTGGGGGGATCATA
ATCATTGCCACTTGTTTCTGGTGTCTTTCCAATATATATTGTGTTTTT

CDS

1089 bp

>Os07t0658300-03 Splicing isoform of SPIN6
ATGGTGTCCAGTCAGGATTCCCCGTTGTCGATGGGAGATATTCTTTCTTCTTTGGATGCT
GGAATTTCCTTACCTGGTCCTGGACCTGAATATTCTGTAGACAGGCAGTCCATCAAATCC
AATGGAACTCAGATGCATGTGAAGCGCTCCAACTTTTGGGGACGGAACAATGGAAGAAAA
AGTCAACAGTCAGAATTGGCTGATTCATCGGGTGAAGAAGAGCTTGCTATCCAAAGACTG
GAGATCACAAAGAATGACCTCCAGATCAGAATCGCGAAAGAGGCTAGAGGAAATGCAATC
TTACAAGCAAGTTTGGAAAGAAGAAAACAAGCACTACATGAGCGCCGTTTGGCTCTGGAG
CAGGATGTTTCAAGGTTGCAAGAGCAGCTACAAGCTGAAAGAGATCTTAGAGCTGCATTG
GAGGTTGGATTAAGCATGTCTTCTGCACATATTTCTAGTTCACGTTCTATGGATTCAAAG
ACGAAGGCAGAGCTTGAGGAGATTGCTCTTGCGGAGGCTGATGTTGCAAGGTTAAAGCAG
AAGGTTGCGGAGCTCCATCTCCAACTCAACCAGCAGCGTCAACATCAGTATGGCTCTTTG
GCAGATGCAAATGATCGTTATCAACATCTTCCAAACCATCTCCCACAGAACTTTGTTCAA
TCAGGTTTTGATATGAACCTTGCTTTCTGTAATCAGGAGAAGAAGCAAAGGAATGAGCAG
GGCCCCGCAGGTGCATCGCATTGGAGAAGCATCAAGCAGCACGTGCTACCTCATGGTTCT
TCAAGGCCCTTCTCCCGGAAGCACTCCATGGACGCCTCGTCGAGTGATTCGAGGGAGGCA
TCAACGAGCATGCCAGCGGATGGCAATTCCATGTCCGTGAACATCCCGAAGGCAACCGAG
GGCGTCGAGTACGGGAGGCAAGCTCCCGTGGCATCGTCCACTCTGGTCGAACTGACGACC
AGGCTAGATTTCTTCAAAGAACGGCGGTCACAATTAATGGAGCAACTCCACAGCCTGGAT
TTAGGAAATGGATCAGCTAATCATGGTTTCCCATACAAGTCTTCGTCACCTTGGAACAGT
CCAAGGTAG

Protein

363 aa

>Os07t0658300-03 Splicing isoform of SPIN6
MVSSQDSPLSMGDILSSLDAGISLPGPGPEYSVDRQSIKSNGTQMHVKRSNFWGRNNGRK
SQQSELADSSGEEELAIQRLEITKNDLQIRIAKEARGNAILQASLERRKQALHERRLALE
QDVSRLQEQLQAERDLRAALEVGLSMSSAHISSSRSMDSKTKAELEEIALAEADVARLKQ
KVAELHLQLNQQRQHQYGSLADANDRYQHLPNHLPQNFVQSGFDMNLAFCNQEKKQRNEQ
GPAGASHWRSIKQHVLPHGSSRPFSRKHSMDASSSDSREASTSMPADGNSMSVNIPKATE
GVEYGRQAPVASSTLVELTTRLDFFKERRSQLMEQLHSLDLGNGSANHGFPYKSSSPWNS
PR*

5'UTR

chr07:27718522..27718737 (+ strand) : 216 bp

chr07:27719100..27719249 (+ strand) : 150 bp

CDS

chr07:27719250..27719420 (+ strand) : 171 bp

chr07:27719633..27719682 (+ strand) : 50 bp

chr07:27720072..27720132 (+ strand) : 61 bp

chr07:27720212..27720295 (+ strand) : 84 bp

chr07:27720505..27720618 (+ strand) : 114 bp

chr07:27720713..27720879 (+ strand) : 167 bp

chr07:27721138..27721207 (+ strand) : 70 bp

chr07:27721904..27722086 (+ strand) : 183 bp

chr07:27722198..27722386 (+ strand) : 189 bp

3'UTR

chr07:27722387..27722659 (+ strand) : 273 bp

FASTA

>Os07t0658300-03 class=Sequence position=chr07:27718522..27722659 (+ strand)
GATGAGCACC TGAGGTGTTC CCTATCACCT GATTCTCAAA TTGAAGATAG CGGAAGTGAA GAGTCAACAG ATGATGAAAC
TGTGGATATC AAGGACAGTG GATTTCATGA TGCAGAGAAT GATGCAGATC AAGAATTAGA TGACTCTGAG CGCATATTGA
GTGGAAAATT AAGTGAAACC AGTGCATGCA CTGCTGGTGA CCTCTATGAC TACAAGGTTT GGTGTTTGCA GTCTTAAAAT
TTTTAATCGG TAGTAAGTTT GATCTAATAC AATCATATAT ACAGTTCGAA TATTTTCAAG TCAATCATAT ATACACGGAA
AAAGGTTTAA GATTCCAATT CCACTGATGA GAAGTTTTTT TTCTTCCCTT TGCACATGCA GTAGTTCTTT TCACTATATA
GTAGCATAAT CTTATCGCGC CTATCCTTAC ATATTTTTGG TGGTTCATGA TATGAAGCAT TCTGAGTAGC TTAATCAGAA
ACCAACTTGG CTTTTAATTT TTATTTGATT AGCAAGTTCA TCTGTCAAAA ATCATGATGT GGCTTATGCT TTTGTTCTCA
TTGCAACATG AACGACAGGT AGCTGATGAT GATTCAGACG GTGAACCTTC TACAGAAGAT AAGGCTTTGG AAACAAAGGT
GGATGTAAAT GATGCCCAGC ATAGTCATTT AGCTGAAAAT GTTTCAGTGA ATGTCCAGAG ATCACCGAAT GAAAAAGATC
CACCAAATAT GGTGTCCAGT CAGGATTCCC CGTTGTCGAT GGGAGATATT CTTTCTTCTT TGGATGCTGG AATTTCCTTA
CCTGGTCCTG GACCTGAATA TTCTGTAGAC AGGCAGTCCA TCAAATCCAA TGGAACTCAG ATGCATGTGA AGCGCTCCAA
CTTTTGGGGA CGGAACAATG TAAGTGAGAA CTTTTGTCCT TTACTGTATC TCCTCAGAAA GTTCATGTTA CTTGAAGGGA
AGTAGAATTG TGACCACTGA CTTATGGTTC TGTGATATTC TTTAAAGAAC ATTATGGTTT CCTCTGGGAA AACATTAGGA
GATATGCACT CCTTAGGACA CTATCAGTGT ATAAAGTTGT TTCAAGTGAT TTACACATTC GGTTTATGCA GGGAAGAAAA
AGTCAACAGT CAGAATTGGC TGATTCATCG GGTGAAGAAG AGTAAGTCCC CATTCCATTT TCGTGTTTAA ATGATTGTTT
CATGTAAAAG GATAGAGTTG AAGAGTTAGT TATTCTTGAA GTTGTTCCAT CAATACATTT GCTTCTGGTG TTCTGCCTGC
TGGATCATTT TTCTGTTACT AGTTAAGTTG GAGATACATC CATTCAGGTA AAATATGTAG CAACAGCTTT CTATGATAAC
CATTGTTTAG ACCTATTGAG AAGTTGTTTC TGTGCTAGCC TTTTGGCTAG TGCTACCATT GACTGGTAAT GATAGGACTG
AGCATTATTG TTTTGTAGCC TTAAAACTTC TCATTGAATA ATTGTATCAA AATAGCAGTG TGATGGATTG ATTTAATGTT
AATTACTCTT AACTGTTAAA TTTCTTTCAG GCTTGCTATC CAAAGACTGG AGATCACAAA GAATGACCTC CAGATCAGAA
TCGCGAAAGA GGTACAAAGG GAATAGTACA TGTATACTCA AGACTTTTGA TTTACAGTAA TACTAAAAAC TAATTGGAAA
TGCTTCTCAG GCTAGAGGAA ATGCAATCTT ACAAGCAAGT TTGGAAAGAA GAAAACAAGC ACTACATGAG CGCCGTTTGG
CTCTGGAGCA GGATGTATGC TATATTCTTT TACCCTATGA ATTAGTTATT TCATTCCATG CTTCCAAAAT ATGCTGAAAA
TTTCACCATC TGTAGTAACA GTTTCAATCA ACTTTTATGT TGTATGTTTT ATTGAACAAT TCACTGTCAG GCTTTTAAAT
ACAAACACGT GGACTTTAAG ACAGTTTCTT ACTTTGTTTG ATGGCAACTG CTTGTACCTC TAGGTTTCAA GGTTGCAAGA
GCAGCTACAA GCTGAAAGAG ATCTTAGAGC TGCATTGGAG GTTGGATTAA GCATGTCTTC TGCACATATT TCTAGTTCAC
GTTCTATGGA TTCAAAGGTA CTCAAATGTT ATGCAACTTG ACACTGATGA TCATATATAC TCTGTGGGCT TATTGATGGA
ATCTAATTTC TTCTTTGTGC TTCCCTTAAA GACGAAGGCA GAGCTTGAGG AGATTGCTCT TGCGGAGGCT GATGTTGCAA
GGTTAAAGCA GAAGGTTGCG GAGCTCCATC TCCAACTCAA CCAGCAGCGT CAACATCAGT ATGGCTCTTT GGCAGATGCA
AATGATCGTT ATCAACATCT TCCAAACCAT CTCCCACAGT AAGAAACCAT ATTTTTCATA GTTAACATTC ATTTCAATTT
TGTTTGAACT GTGGTCCAGA CTCCAGAACA TCCATAAATA TCAAGTATTG GCTGCTACAC ATTTTAGTAA CAAAAACATG
ATGTTTCTGC TGTCAACTGC TGGCTTACTA TATCTGCTCA AACCATATAT GTTTAACAGT TCAATGTGTT ATATATACTC
TAGTTGTCCT TTGAAATTGC AATACATTAA CTATGCGAAT ATTTTGTTGC CAACAGGAAC TTTGTTCAAT CAGGTTTTGA
TATGAACCTT GCTTTCTGTA ATCAGGAGAA GAAGCAAAGG AATGAGGTTA GCTAAAGATT TTCCCTTAAT CTTCTATGCT
TAAATTTACG ACAACAGAAG TTGGAAAATA CAGAACCAAC CAATTAGCTG ATGTTAGCTC ATTTTCTCAT TGCGCTATCA
TTATGGTGTG CTTAAGGTGT AAAATGCCCC AATTATTTTT TGTGCTATAT TTCCAACCTT TCCATATGGT TGACTGTGCT
CATCCAATGT TTCAATTGCT AGGTATAGCT CGAATGATAC AAACTCCTAG TAGATTATGC CAAAATTTAA TATCCATGCA
TCACAATTGT TTGGCCCAAC CAtagtcaca ggaaacggcg gtggcagcga tcctcgaccc gggaacgccg tccctgtccc
gaaaacacgg ggtcattttc gtccccacct tgtaaaaacc tctcgcaagt agcgtatcac gttcctcgat cccgttcctc
gatcccattg acccaggaac tttgtgacta tggGCCCAAC CACCAATTTA TACCCCCAAA GCCATCCAGG TCAGGTGGGT
CAAACAACCA CTTAAGGGGG ACGTTCGCCC ACTAGCCTTC TCTCGTTGCA CCTCTAGTTC TCAGCGTCTT ATGGGCCTGC
AGGTTTATAG AAAAGCAAAG GCACCGATGA GTAATTGTCT ACTTGCAATG TAAAAAAATC CCATTTCGTC CACTGATGGC
ACAACAACGT TCTGTGTGAC AGCAGGGCCC CGCAGGTGCA TCGCATTGGA GAAGCATCAA GCAGCACGTG CTACCTCATG
GTTCTTCAAG GCCCTTCTCC CGGAAGCACT CCATGGACGC CTCGTCGAGT GATTCGAGGG AGGCATCAAC GAGCATGCCA
GCGGATGGCA ATTCCATGTC CGTGAACATC CCGAAGGCAA CCGAGGTAAA GGAAAAACCA CTGCTTCCGA ACTGAAGGGT
GCGGTAGTGT CGAAATAAAG ACCACACCGC TTCTCATTCA ATACGAGTAT TCAATTCTCT TGTATCACTA TCACAGGGCG
TCGAGTACGG GAGGCAAGCT CCCGTGGCAT CGTCCACTCT GGTCGAACTG ACGACCAGGC TAGATTTCTT CAAAGAACGG
CGGTCACAAT TAATGGAGCA ACTCCACAGC CTGGATTTAG GAAATGGATC AGCTAATCAT GGTTTCCCAT ACAAGTCTTC
GTCACCTTGG AACAGTCCAA GGTAGGAGGA GACTTCTTTT TTTTTGCGAC ATTCTGTTTG TATATTCTTG GTAAAGAATC
CTCTCGTTTT CTTTCGTAGA AGCTGCTAGT GAGAATGAAT GTATATCCCT TTCCTGTTCG TCTTCCATTT GTTTTTGTTT
TGTTGTTGCA TGCGGCAGCC TCTTTTGGGT GTGATTTTGT AATATGCTTT TTGTAATCTA TTGTATGTAA CACGAGTTGG
GGGGATCATA ATCATTGCCA CTTGTTTCTG GTGTCTTTCC AATATATATT GTGTTTTT