Os07t0669500-01

Locus

Os07g0669500

Description

ERF transcription factor, Mediation of the transition from spikelet to floret meristem, Determination of panicle branching and spikelet formation

RAP-DB Gene Symbol Synonym(s)

FZP, SGDP7, BFL1, COS1, qSrn7/FZP, qSrn7

RAP-DB Gene Name Synonym(s)

FRIZZY PANICLE, Small Grain and Dense Panicle 7, BRANCHED FLORETLESS 1, CONTROL OF SECONDARY BRANCH 1

CGSNL Gene Symbol

FZP

CGSNL Gene Name

FRIZZY PANICLE

Oryzabase Gene Symbol Synonym(s)

fzp*, fzp, OsBD1, BD1, OsERF#078, OsERF078, OsERF78, ERF78, AP2/EREBP#133, AP2/EREBP133, BFL1

Oryzabase Gene Name Synonym(s)

frizzy panicle, BRANCHED SILKLESS 1 homolog, ethylene response factor 78, APETALA2/ethylene-responsive element binding protein 133, BRANCHED FLORETLESS 1, FRIZZLE PANICLE

Transcript Evidence

AK105365

AB103120

Protein Evidence

Q8H3Q1

Literature

PMID: 30131566

PMID: 30101570

PMID: 29085070

PMID: 26744119

PMID: 14503923

PMID: 12835399

Note

Manual Curation

November 15, 2018

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Functional domain (InterPro)

AP2/ERF domain superfamily (IPR036955)

DNA-binding domain superfamily (IPR016177)

AP2/ERF domain (IPR001471)

Full-length cDNA

001-119-F02 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0669500-01)

RiceXPro (AK105365)

Others

Oryzabase (117)

KEGG (Os07t0669500-01)

Transcript

1488 bp

>Os07t0669500-01 ERF transcription factor, Mediation of the transition from spikelet to floret meristem, Determination of panicle branching and spikelet formation
ACACACAAGCTAAGCTTAGCTCGAGCTCATTCATATACCTTAGCTTAGCTAAAGCCTAGC
TCACTCTCACTCTCACTCTTGCATTGCATTGCAATATTGCAATATTGCATTGGTCATGAA
CACTCGAGGCAGCGGCAGTAGCAGCAGCAGCAGCAGCAGCCAGGCCAGCCTGATGGCGTT
CTCGGAGCCGCCGAAGCCGGCGAGCCAGCCGTCGCCGCCGTCGTCGCCGATGAGCGagcg
gccgccgtcggggcgcagcaggcggcgcgcgcaggagccagggaggttcctcggcgtgcg
gcggcggccgtgggggaggtacgctgccgagatacgcgacccgaccaccaaggagcggca
ctggctgggcacgttcgacacggcgcaggaggcggcgctggcgtacgaccgcgccgcGCT
GTCCATGAAGGGCGCCCAGGCGCGCACCAACTTCGTCTACACCCACGCCGCCTACAACTA
CCCGCCGTTCCTCGCGCCGTTCCACGCGCCGCAGTACGCCGCTGCCGCCGCCGCGCCGTC
CTCGGTGCAGTACGGCGGCGGCGTGGGCGCGGCGCCGCACATTGGCTCGTACGGTCACCA
CCACCACCACCACCACCACCACGGACATGGcgcggcgtcgggcgcgtcgtcggtgggcga
gtgctcgacgatgccggtgatggtcccggttgatccccaccgctccagcatgtcgtcgtc
gctgctggacatggacaggaacggccacgacttcctcttctccggcgccgacgacaactc
cgggtACCTGAGCAGCGTGGTGCCGGAGAGCTGCCTCCGGCcgaggggcggcggcgccgc
ggccgatcatcaggacatgcggcgctactccgacgccgacgcctacggcatgatggggct
ccgggaggacgtcgacgacctcgcgcagatggtcgccggcttctggggcggcggcgacgc
ggcggaccagctcggcgcCTGCGGGTTCCCGGCGAGCGGCGGCGCCGCCGACATGGTCGC
CTCGTCGCAGGGCTCCGACTCCTACTCTCCATTCAGCTTCCTCTCCCATTGATCGAGTTG
CACCGGGCATTGCATGGCTAATCACGCACTTTGCCTCTGAGCGATCATGCATATATCATT
TCCTGTCTACCATGATCAGATCGAGTTGATCTTGATCAATCTGCGTTTGATCGATCGAGC
AAGAgatcgagtagtatagcagcagcagcagcagcagctagcagtagatcgaacaagaag
agtggcttggcgccATTTCTAGTTAATTAAGTAGAGCTTCTTCAAATATGTACTTAGGCA
GATGATCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTTCTATATTAGCA
TTAGTACCTACTTAGCCATCATATTCATGCATGCATGCATGATATATTGCATGGCACAGC
TTGTTAATTTCTTCTAGCATCTTAATCAATTAATCCATGACCTGGTTC

CDS

957 bp

>Os07t0669500-01 ERF transcription factor, Mediation of the transition from spikelet to floret meristem, Determination of panicle branching and spikelet formation
ATGAACACTCGAGGCAGCGGCAGTAGCAGCAGCAGCAGCAGCAGCCAGGCCAGCCTGATG
GCGTTCTCGGAGCCGCCGAAGCCGGCGAGCCAGCCGTCGCCGCCGTCGTCGCCGATGAGC
Gagcggccgccgtcggggcgcagcaggcggcgcgcgcaggagccagggaggttcctcggc
gtgcggcggcggccgtgggggaggtacgctgccgagatacgcgacccgaccaccaaggag
cggcactggctgggcacgttcgacacggcgcaggaggcggcgctggcgtacgaccgcgcc
gcGCTGTCCATGAAGGGCGCCCAGGCGCGCACCAACTTCGTCTACACCCACGCCGCCTAC
AACTACCCGCCGTTCCTCGCGCCGTTCCACGCGCCGCAGTACGCCGCTGCCGCCGCCGCG
CCGTCCTCGGTGCAGTACGGCGGCGGCGTGGGCGCGGCGCCGCACATTGGCTCGTACGGT
CACCACCACCACCACCACCACCACCACGGACATGGcgcggcgtcgggcgcgtcgtcggtg
ggcgagtgctcgacgatgccggtgatggtcccggttgatccccaccgctccagcatgtcg
tcgtcgctgctggacatggacaggaacggccacgacttcctcttctccggcgccgacgac
aactccgggtACCTGAGCAGCGTGGTGCCGGAGAGCTGCCTCCGGCcgaggggcggcggc
gccgcggccgatcatcaggacatgcggcgctactccgacgccgacgcctacggcatgatg
gggctccgggaggacgtcgacgacctcgcgcagatggtcgccggcttctggggcggcggc
gacgcggcggaccagctcggcgcCTGCGGGTTCCCGGCGAGCGGCGGCGCCGCCGACATG
GTCGCCTCGTCGCAGGGCTCCGACTCCTACTCTCCATTCAGCTTCCTCTCCCATTGA

Protein

319 aa

>Os07t0669500-01 ERF transcription factor, Mediation of the transition from spikelet to floret meristem, Determination of panicle branching and spikelet formation
MNTRGSGSSSSSSSSQASLMAFSEPPKPASQPSPPSSPMSERPPSGRSRRRAQEPGRFLG
VRRRPWGRYAAEIRDPTTKERHWLGTFDTAQEAALAYDRAALSMKGAQARTNFVYTHAAY
NYPPFLAPFHAPQYAAAAAAPSSVQYGGGVGAAPHIGSYGHHHHHHHHHGHGAASGASSV
GECSTMPVMVPVDPHRSSMSSSLLDMDRNGHDFLFSGADDNSGYLSSVVPESCLRPRGGG
AAADHQDMRRYSDADAYGMMGLREDVDDLAQMVAGFWGGGDAADQLGACGFPASGGAADM
VASSQGSDSYSPFSFLSH*

5'UTR

chr07:28300975..28301089 (- strand) : 115 bp

CDS

chr07:28300018..28300974 (- strand) : 957 bp

3'UTR

chr07:28299602..28300017 (- strand) : 416 bp

FASTA

>Os07t0669500-01 class=Sequence position=chr07:28299602..28301089 (- strand)
ACACACAAGC TAAGCTTAGC TCGAGCTCAT TCATATACCT TAGCTTAGCT AAAGCCTAGC TCACTCTCAC TCTCACTCTT
GCATTGCATT GCAATATTGC AATATTGCAT TGGTCATGAA CACTCGAGGC AGCGGCAGTA GCAGCAGCAG CAGCAGCAGC
CAGGCCAGCC TGATGGCGTT CTCGGAGCCG CCGAAGCCGG CGAGCCAGCC GTCGCCGCCG TCGTCGCCGA TGAGCGagcg
gccgccgtcg gggcgcagca ggcggcgcgc gcaggagcca gggaggttcc tcggcgtgcg gcggcggccg tgggggaggt
acgctgccga gatacgcgac ccgaccacca aggagcggca ctggctgggc acgttcgaca cggcgcagga ggcggcgctg
gcgtacgacc gcgccgcGCT GTCCATGAAG GGCGCCCAGG CGCGCACCAA CTTCGTCTAC ACCCACGCCG CCTACAACTA
CCCGCCGTTC CTCGCGCCGT TCCACGCGCC GCAGTACGCC GCTGCCGCCG CCGCGCCGTC CTCGGTGCAG TACGGCGGCG
GCGTGGGCGC GGCGCCGCAC ATTGGCTCGT ACGGTCACCA CCACCACCAC CACCACCACC ACGGACATGG cgcggcgtcg
ggcgcgtcgt cggtgggcga gtgctcgacg atgccggtga tggtcccggt tgatccccac cgctccagca tgtcgtcgtc
gctgctggac atggacagga acggccacga cttcctcttc tccggcgccg acgacaactc cgggtACCTG AGCAGCGTGG
TGCCGGAGAG CTGCCTCCGG Ccgaggggcg gcggcgccgc ggccgatcat caggacatgc ggcgctactc cgacgccgac
gcctacggca tgatggggct ccgggaggac gtcgacgacc tcgcgcagat ggtcgccggc ttctggggcg gcggcgacgc
ggcggaccag ctcggcgcCT GCGGGTTCCC GGCGAGCGGC GGCGCCGCCG ACATGGTCGC CTCGTCGCAG GGCTCCGACT
CCTACTCTCC ATTCAGCTTC CTCTCCCATT GATCGAGTTG CACCGGGCAT TGCATGGCTA ATCACGCACT TTGCCTCTGA
GCGATCATGC ATATATCATT TCCTGTCTAC CATGATCAGA TCGAGTTGAT CTTGATCAAT CTGCGTTTGA TCGATCGAGC
AAGAgatcga gtagtatagc agcagcagca gcagcagcta gcagtagatc gaacaagaag agtggcttgg cgccATTTCT
AGTTAATTAA GTAGAGCTTC TTCAAATATG TACTTAGGCA GATGATCTCT CTCTCTCTCT CTCTCTCTCT CTCTCTCTCT
CTCTCTCTTC TATATTAGCA TTAGTACCTA CTTAGCCATC ATATTCATGC ATGCATGCAT GATATATTGC ATGGCACAGC
TTGTTAATTT CTTCTAGCAT CTTAATCAAT TAATCCATGA CCTGGTTC