Os07t0671700-01

Locus

Os07g0671700

Description

Similar to Arginine methyltransferase-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PRMT4

CGSNL Gene Name

PROTEIN ARGININE METHYLTRANSFERASE 4

Oryzabase Gene Symbol Synonym(s)

OsPRMT4

Oryzabase Gene Name Synonym(s)

protein arginine methyltransferase 4

Transcript Evidence

AK065980 (DDBJ, Best hit)

Protein Evidence

NP_001150868.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: methyltransferase activity (GO:0008168)

Functional domain (InterPro)

Skb1 methyltransferase (IPR007857)

Full-length cDNA

J013049G01 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0671700-01)

RiceXPro (AK065980)

Others

Oryzabase (9674)

KEGG (Os07t0671700-01 (EC:2.1.1.125))

Transcript

2146 bp

>Os07t0671700-01 Similar to Arginine methyltransferase-like protein.
TACTCCACCCACGCGTACAAACAGCGAGCTCCTCCACCCCGCGACGCCGCGCGCCTCCGC
CCAAAACCCTAGCCACCCCGCGTCGCCCGCCTCGGCGCGCCCAAAACCCTAGGGCATCCC
GGATCCGAAGCTCCCGGCCCCAATGGCGTCGCCGGACCTGTTCCCGAACGTCTCCTTCTC
CCATGTCTCCGTCCCCGCCGCCGCGGGCGCGTCGACGGAGGTCACCGGCGGCGCCACGGC
CGTGTTCGGCGGGGACGCGTCCACCGGGGCCCCGCGCCTCAGCCTCGTCTGGTCCGGGGA
GACCCAGGCGAAGCACACGCTCGAGATCGATCTCTCTGACGCGCAGATATTTAAGCTGGG
GCCGACGGAGTGGCTGTGCGTGAGCGGCGAGTCGGAGGCTAAGGACGGTGTGGAGGAGAA
GTCATATTCAAGAGCAATTAAGGTTGTTCTTAGGACAGAAGCTGAGAGCAAAGCCTTCTA
TTTAGCTTTTCAACAATGGAAACACCGAGTGATTAGTGGAAAAGCTGGTGAACCTTTGGA
AAATGGATTAATAATTGGTTCTAAAAGCAAATTTGATACAAAAATTGAGGCCTCATCAGC
AAAGATGTATTTCCACTACTATGGCCAGTTATTACATCAGCAAAATATGTTGCAAGACTT
TGTCAGGACAGGAACATACTATGCTGCTGTAATGGAAAATCGATCCGATTTTGAGGGTCG
AGTTGTGGTTGATGTTGGAGCTGGTAGTGGCATTCTTTCATTATTTGCTGCACAGGCTGG
TGCCAGACATGTATATGCAGTTGAGGCATCTGAAATGGCTGAACATGCTCAGCGTCTTAT
TTCTGGAAACCCATCTCTTGGACAAAGAATAACGGTCATCAAAGGCAAAGTTGAGGAAGT
TGAACTTCCAGAGAAAGCTGACATACTTATTTCGGAGCCTATGGGAACCCTCTTGGTGAA
TGAAAGGATGCTGGAGTCCTATGTTATAGCTAGAGACAGATTCCTTGTGCCAGGTGGTAA
AATGTTTCCAACAACTGGAAGGATTCATATGGCTCCATTTTCCGATGAATACCTCTATGT
TGAAATGGCAAACAAGGCTCTCTTCTGGCAGCAGCATAACTTTTTTGGTGTTGATCTTAC
ACCTTTGCATGGTTCAGCATTCCAGGGGTATTTTTCACAGCCTGTGGTGGATGCATTCGA
TCCAAGATTATTGGTTTCTCCGCCTACGTTTCATACGCTTGATTTCACTACCATGAAGGA
AGAGGAGCTTTACGAGATTGACATTCCCCTAAATTTTGTGGCCTCTGTTGGCACTAGGGT
GCATGGGCTAGCTTGTTGGTTTGATGTATTGTTCAATGGGAGCACTGTCCAGAGGTGGCT
TACCACTGCTCCAGGCTCCCCTACGACTCACTGGTATCAACTACGATGCATACTTTCACA
GCCATTATATGTCATGGCAGGACAAGAAATAACAGGACGACTTCATCTGGTAGCCCACAG
TGCACAAAGCTACACGATATACTTGACGATGTCAGCTAAAATGTGGGGTGAGGGGGCAGA
ACAAGGTGGCATCCTGCAGACATCCACAGCCAAACTTGAACTCAAGGAGCCATACTACAG
GCTGTCTCAACCACAACCATATGTGATGCAACAAGACCAGCAGCAGCAGCAGTTACCATC
TTTGCAGCCACAGAGTCCTCTCTGGGACTATCACTACGGACAAGATTAGTTGTCTGGCCT
CAGCTATTGAACATTGGCAAGAATAGCAGGGATCTGAGCAGCAGATGCAAGATGGTCTTA
GCCCTAGTATAACGATTGAACCAGACCAAGACTCGGCGGCCTTCACTAGATAGCTCGTAA
GCCGGAGTTGCTTCAGGCAAACAACTCCAGGCCTGTACAACAGTATGCTCCTACCTGATG
TTGCTAGGCGTTAGCTGTCAGTGGCTAACATTGCATTCGTTGTGTACGAGAGGTTGTGCA
GCTGTAGCTAATTGTGCTCGTGTCTGCACCGTTATTTAAAGGGGGTCAAATACAATAAGT
GTATCTGTTTGCAGGAAAAGCTCAACGACAAAGGCGTCTAACTAGAACGATTGTTGTGTA
TGTTCTTATGTATTATTGTTTTATTTAATTTAAAAATGGTTGGTCG

CDS

1587 bp

>Os07t0671700-01 Similar to Arginine methyltransferase-like protein.
ATGGCGTCGCCGGACCTGTTCCCGAACGTCTCCTTCTCCCATGTCTCCGTCCCCGCCGCC
GCGGGCGCGTCGACGGAGGTCACCGGCGGCGCCACGGCCGTGTTCGGCGGGGACGCGTCC
ACCGGGGCCCCGCGCCTCAGCCTCGTCTGGTCCGGGGAGACCCAGGCGAAGCACACGCTC
GAGATCGATCTCTCTGACGCGCAGATATTTAAGCTGGGGCCGACGGAGTGGCTGTGCGTG
AGCGGCGAGTCGGAGGCTAAGGACGGTGTGGAGGAGAAGTCATATTCAAGAGCAATTAAG
GTTGTTCTTAGGACAGAAGCTGAGAGCAAAGCCTTCTATTTAGCTTTTCAACAATGGAAA
CACCGAGTGATTAGTGGAAAAGCTGGTGAACCTTTGGAAAATGGATTAATAATTGGTTCT
AAAAGCAAATTTGATACAAAAATTGAGGCCTCATCAGCAAAGATGTATTTCCACTACTAT
GGCCAGTTATTACATCAGCAAAATATGTTGCAAGACTTTGTCAGGACAGGAACATACTAT
GCTGCTGTAATGGAAAATCGATCCGATTTTGAGGGTCGAGTTGTGGTTGATGTTGGAGCT
GGTAGTGGCATTCTTTCATTATTTGCTGCACAGGCTGGTGCCAGACATGTATATGCAGTT
GAGGCATCTGAAATGGCTGAACATGCTCAGCGTCTTATTTCTGGAAACCCATCTCTTGGA
CAAAGAATAACGGTCATCAAAGGCAAAGTTGAGGAAGTTGAACTTCCAGAGAAAGCTGAC
ATACTTATTTCGGAGCCTATGGGAACCCTCTTGGTGAATGAAAGGATGCTGGAGTCCTAT
GTTATAGCTAGAGACAGATTCCTTGTGCCAGGTGGTAAAATGTTTCCAACAACTGGAAGG
ATTCATATGGCTCCATTTTCCGATGAATACCTCTATGTTGAAATGGCAAACAAGGCTCTC
TTCTGGCAGCAGCATAACTTTTTTGGTGTTGATCTTACACCTTTGCATGGTTCAGCATTC
CAGGGGTATTTTTCACAGCCTGTGGTGGATGCATTCGATCCAAGATTATTGGTTTCTCCG
CCTACGTTTCATACGCTTGATTTCACTACCATGAAGGAAGAGGAGCTTTACGAGATTGAC
ATTCCCCTAAATTTTGTGGCCTCTGTTGGCACTAGGGTGCATGGGCTAGCTTGTTGGTTT
GATGTATTGTTCAATGGGAGCACTGTCCAGAGGTGGCTTACCACTGCTCCAGGCTCCCCT
ACGACTCACTGGTATCAACTACGATGCATACTTTCACAGCCATTATATGTCATGGCAGGA
CAAGAAATAACAGGACGACTTCATCTGGTAGCCCACAGTGCACAAAGCTACACGATATAC
TTGACGATGTCAGCTAAAATGTGGGGTGAGGGGGCAGAACAAGGTGGCATCCTGCAGACA
TCCACAGCCAAACTTGAACTCAAGGAGCCATACTACAGGCTGTCTCAACCACAACCATAT
GTGATGCAACAAGACCAGCAGCAGCAGCAGTTACCATCTTTGCAGCCACAGAGTCCTCTC
TGGGACTATCACTACGGACAAGATTAG

Protein

529 aa

>Os07t0671700-01 Similar to Arginine methyltransferase-like protein.
MASPDLFPNVSFSHVSVPAAAGASTEVTGGATAVFGGDASTGAPRLSLVWSGETQAKHTL
EIDLSDAQIFKLGPTEWLCVSGESEAKDGVEEKSYSRAIKVVLRTEAESKAFYLAFQQWK
HRVISGKAGEPLENGLIIGSKSKFDTKIEASSAKMYFHYYGQLLHQQNMLQDFVRTGTYY
AAVMENRSDFEGRVVVDVGAGSGILSLFAAQAGARHVYAVEASEMAEHAQRLISGNPSLG
QRITVIKGKVEEVELPEKADILISEPMGTLLVNERMLESYVIARDRFLVPGGKMFPTTGR
IHMAPFSDEYLYVEMANKALFWQQHNFFGVDLTPLHGSAFQGYFSQPVVDAFDPRLLVSP
PTFHTLDFTTMKEEELYEIDIPLNFVASVGTRVHGLACWFDVLFNGSTVQRWLTTAPGSP
TTHWYQLRCILSQPLYVMAGQEITGRLHLVAHSAQSYTIYLTMSAKMWGEGAEQGGILQT
STAKLELKEPYYRLSQPQPYVMQQDQQQQQLPSLQPQSPLWDYHYGQD*

5'UTR

chr07:28402333..28402474 (+ strand) : 142 bp

CDS

chr07:28402475..28402678 (+ strand) : 204 bp

chr07:28402841..28402912 (+ strand) : 72 bp

chr07:28403736..28403844 (+ strand) : 109 bp

chr07:28404551..28404694 (+ strand) : 144 bp

chr07:28404791..28404894 (+ strand) : 104 bp

chr07:28404979..28405077 (+ strand) : 99 bp

chr07:28405160..28405229 (+ strand) : 70 bp

chr07:28405705..28405801 (+ strand) : 97 bp

chr07:28406021..28406075 (+ strand) : 55 bp

chr07:28407085..28407168 (+ strand) : 84 bp

chr07:28407429..28407506 (+ strand) : 78 bp

chr07:28407605..28407708 (+ strand) : 104 bp

chr07:28407790..28407962 (+ strand) : 173 bp

chr07:28408056..28408213 (+ strand) : 158 bp

chr07:28408889..28408924 (+ strand) : 36 bp

3'UTR

chr07:28408925..28408964 (+ strand) : 40 bp

chr07:28409176..28409552 (+ strand) : 377 bp

FASTA

>Os07t0671700-01 class=Sequence position=chr07:28402333..28409552 (+ strand)
TACTCCACCC ACGCGTACAA ACAGCGAGCT CCTCCACCCC GCGACGCCGC GCGCCTCCGC CCAAAACCCT AGCCACCCCG
CGTCGCCCGC CTCGGCGCGC CCAAAACCCT AGGGCATCCC GGATCCGAAG CTCCCGGCCC CAATGGCGTC GCCGGACCTG
TTCCCGAACG TCTCCTTCTC CCATGTCTCC GTCCCCGCCG CCGCGGGCGC GTCGACGGAG GTCACCGGCG GCGCCACGGC
CGTGTTCGGC GGGGACGCGT CCACCGGGGC CCCGCGCCTC AGCCTCGTCT GGTCCGGGGA GACCCAGGCG AAGCACACGC
TCGAGATCGA TCTCTCTGAC GCGCAGGTAT TCCTCCGTGA TCTCGATGGT TTATGGGGGG AGGTGGAGTG GGAGTGGCGT
GGGCTGTAGG GCGTGGCCGC GTTGGTTCGA TTCGATTTCA TGGTGGGGCT CTGAGAGGTG CCTCTGCTGT TGCCGTGCGA
TTGGAGGATG AGATTTTGAG TTTTGCAGAT ATTTAAGCTG GGGCCGACGG AGTGGCTGTG CGTGAGCGGC GAGTCGGAGG
CTAAGGACGG TGTGGAGGAG GTACTCTTCA GTAATTTCGC TGTTTTTTTG AGTTATTATG TGCTTTCGTT TGGTCATAAT
GTACATTCCT CTGTTGGATT TCATATTTCT GATGTGCACT GAGCCTTCCA GTATATAACC AGTCCAATTC CCTGATATAC
CACGCCTTGA GCTGTATGCC TGTATGGCTG TATCATGCTC AAGCCAATTT TAAGATGATC TCAAGGTTTA ATTGTTGCAC
GGTAGAGGCA TACCAACATT TTTCTTTTAA AAGATGGCTC AAAAGAAGAT TCAGTGACAT TTTAAATCTG GGGCGAAGAT
GTTGATATTA CTAGTTGAAT AACATGACAC AGTTTGCATT CAAGTTTGTT GTCGGAACAC TCTTTCTTTT GGGGGTCATA
TCTTCATCCA AATCCAACTT AGAGTCTTAG ACACATACTA GTTGAAACAC CTAAAGAAAA AGGCTGGAGT GTGATATGAT
CTCTCTCGAT ACCATCCTAT ATGTACTAAA AGCAACTTTC TGAAACTGCA AAGGATATGC TCTATGATTG TGAGATGCGA
GACATAACTA GAATTTTCCT GCCTATCTGA AAGTCTGACT TATAGAACTC TTGATAGTCT GCTGCCTATT GTTACGTTAT
AAAGGTGAAT TTCCTGCTGA CTGCTGTGTC ACACTTCTTT GTTGCCATCT GCTAAATAAC TCATCGCATA GACTTTCTGA
TAATGTTGCC TAGAGGTAAA GGTAATATGA CAATTTGTAG ATCATTGTTT GGCCTTTTCT GTTGGAACTT TCTTGTAGCA
CATATTAAAT GGCTTCATGT TAACTCTCAA TTCTTTGAGG CAGAAGTCAT ATTCAAGAGC AATTAAGGTT GTTCTTAGGA
CAGAAGCTGA GAGCAAAGCC TTCTATTTAG CTTTTCAACA ATGGAAACAC CGAGTGATTA GTGGAAAAGC TGGTTTGTCC
TTTCATTTCT TGTTTCAGAT AATTCCAGTA GCATATTTTG TTGCATTATT TCTGAGTCAT CGGCCCATGT TCTCAATGCT
AAATTTCAGA TTATCATGCA TATAGTCAAT TACAGCTCTC CATGTCTGTT TTTCTTTAAG TGCCAATAGC TGCCCTTCAA
TACCAAGTGT TTTTAAGACT AGATAATGTT TTTCACTTTG GTTTGATATA TTCTGCTAGC TCTAGTGCTC TACTATCTAA
TGAAATGCAT AATGCCATTT AACTTGCATA TTTGGTCGTG CCTGGTCTGA TAAAAAAATA ATGCTATTAG GAATTTGTAG
AAGTAGCATG TTTACTGCTT TATATCTGCA CATCCAGTTT TCTTGAAGGA TAACTGTAGT TAATGAAATC AAATTACATC
ATGCATGATT ATATTAATGC ATGTTATTTT GGAGAACATA CATTAATACT TTGCATCATT TCTCTTGGTA GAACTTGGTT
ATGAGATGCT CATTGTAGCA CACCTTTTTG TGCTTCTCTT TGTATTCGTT TCCTTTTTCA AAAGTGTTAT TTGTGACGAA
GCAAAGTGGC AACTAAGGGA CAACATTGAC ATGTTAATCT CAAAACTTAT GCCAACAGTG AAGCCAGAGT CATTAGCCCT
TTTTTTTAAT GTAAAATGCC ATAGATTCTT ATTTCAACAT ATTGCTGCTT CATGGCAGGT GAACCTTTGG AAAATGGATT
AATAATTGGT TCTAAAAGCA AATTTGATAC AAAAATTGAG GCCTCATCAG CAAAGATGTA TTTCCACTAC TATGGCCAGT
TATTACATCA GCAAAATATG TTGCAAGACT TTGTCAGGAC AGGTCAGTAT CTCTGGCCTA TTGTCAAAAG AGTTAAAATA
ATGGCATGAA GGTCTCCTTT CTGTATATAT GTAATTAGTT TACAACCTTT TACTCCAGGA ACATACTATG CTGCTGTAAT
GGAAAATCGA TCCGATTTTG AGGGTCGAGT TGTGGTTGAT GTTGGAGCTG GTAGTGGCAT TCTTTCATTA TTTGCTGCAC
AGGTACACTC CAACATTCTC CATGACTTTT CTAACTTCTT GTTTTTTATA CAAAATAACA GATGATGTTT TATATGTTAA
TATCAGGCTG GTGCCAGACA TGTATATGCA GTTGAGGCAT CTGAAATGGC TGAACATGCT CAGCGTCTTA TTTCTGGAAA
CCCATCTCTT GGACAAAGAA TAACGGTTCG TTTATGTGCC AGTTTGGTTT GGAACTTCCA GGCTTCCTTT TTGCCCTAAA
ATTAATCAGT GTCCCCATCA TAACTAGGTC ATCAAAGGCA AAGTTGAGGA AGTTGAACTT CCAGAGAAAG CTGACATACT
TATTTCGGAG CCTATGGGTA TGCCTCAATG ATAAACTTTC TGGAGCATTT CTTTTCCCAG AGTCACCTGT GGTGTTCCTG
CTTTACATCT TATACCCGTT GCACAATCTA ATAACCGATT CATTGTGTTT GTATACATAT GGATAACTTT CACACTTTGC
AGCTAGGTGA CGGATAAGTA CTAGGTTGCA TTGCCATCTG TTAATCCTGT CAAGAAATTG GCTGTCATAT TTGTAGACAA
ACTATCCGTT GTTAGCATCA ATGTTCCTTT TAATGGATTG TATGGGTTAA GCACTGGCCA TTGGCCAAAT GGTGATAGTA
TATGCGGTAT CCACGGTGTT TATTGAATAG TTGAATACCC AATGTAAACT AGCTAATATT TGAAATGTTA TATTGTTGTT
TGAATTTTGA AATTTGGTAT AGGACAATAA ACTTGTTTCT GTATCTGCTT ATATGTATTA TGTAGTGACT TGTTTTGTCT
ATAATATTTT AGGAACCCTC TTGGTGAATG AAAGGATGCT GGAGTCCTAT GTTATAGCTA GAGACAGATT CCTTGTGCCA
GGTGGTAAAA TGTTTCCAAC AACTGGAAGG TAATCTGAAC CACTCTGGAT ATTTATTGGA AGTTCTGCTT CACAAAATCT
TTAGGTGTTT GATTAGGATT GTTCACTAAA TCATCTGTGC TTACTAAAAC GTCAGAATAG ATCTATTGGC TAAGTTTTCC
AAAAAATAAA CTCAGATGCA TGGCTTTTTA AGCTACTTTT GGCATTCACA ATTACTCACT GATGCCTGAT ATATTAAATA
TTTACTAGGA TTCATATGGC TCCATTTTCC GATGAATACC TCTATGTTGA AATGGCAAAC AAGGTACAGT ATTACACTCC
GATGAAATCT TTTTCCTAAG TTTACTGCAC AATCTTACTA TCCAGTGCTT CTAGTGAGGC TATACTAACC TTGTTGTAAA
TTACTATGTG CAAGTGGGTT GTGAAAACAG TTGGAATTGA ATCGAAAATA TTCAAAACTG TTGTCCGAAA CCATACTTTT
TTTTTCTTGA AATGAGAATA CAAAATGGTA ATGCCAGAAA TGGATATGAC ATTGGAACTT GTTGGAGCGG AAATGTCCAG
AACATCAAAC TGTAACACCA TATGTTTATG TTCACGCGCT TGACCTAGCA ACTACGTAAG ATGAGTTCAG ATACACACTA
TACAACTTGC AATTTATTGA ACACAAAGTA ATGAAAtact cccttcgtcc caaagtatag caacctagta ctcgactaga
caccacttag tactatgaac ctagacagtc ttcatagtac taggtggtgt ctaatcgagt actaggttgt tatactttgg
gacagagggg gtaACTATCA ATTTATTCTC ATCTTTGGAC CGTTACCCTA TCTCTGGATC AACGCCCATA ACATCTGACA
TCCTATATAT AGATATTACT GTTTCAAAAT TTCCCTGGTT CTTTAAATAG GAGATATTGA GAAATGAATT CTCAACTTGT
CCATGCTTTC TGTCAACTGT ATAGCACAGT ACCAAAGTGA GAATGTGTCC ATTTCCCCCA CTTATACCTT GTCTTAACAC
AAAGATAAGC AGCTCTTCTG TGTATTTTCT GAAAAAAGAA AATGCACACT TATTCCTAGC TTTTATGTGT TTTTAGCACA
TCATTTGCTC TATGCGAAAA TCTCATATTT TCGTATGATG ATGCTGGTGG GGGGTTAAAG CCACCTTGTG GTCACTTCCT
ATTTATTCTC ATGTTGTTGA GCAAGTATAT TATCCTTGCT GAAAGTATGT TATTTCAATC CTAAGTGTTT CTTTAGTTTG
ACACATTATA TTTTGGTTGT GTGTCTCTGC AGGCTCTCTT CTGGCAGCAG CATAACTTTT TTGGTGTTGA TCTTACACCT
TTGCATGGTT CAGCATTCCA GGGGTATTTT TCACAGGTAT CTCATCCCTT TTCTTTTCAA CTTTTGACTA GAAAGTACCT
CAATTCAAAA ACAACAATAA ATAGTTCAAT GCACTCTTAC TGGCACCTAA TCTTTCAATT AGCCACCTGT ATTCCAGTTC
CAGTGGTTAA TGCCAAGAAT TGAACCCCGA GAATGGCTAT TACTTAAGTA ATTCTATATA ACCCATGACT GCATTGTTGA
TCAGAGTGAC TACTGACTAG TTATCAAATC TAAACGCCCC TGCAATTCTC ATGCAGCCTG TGGTGGATGC ATTCGATCCA
AGATTATTGG TTTCTCCGCC TACGTTTCAT ACGCTTGATT TCACTACCAT GAAGGTAAAT ATTTCTTTAT TGGTGATGAG
ACTGAAACTA CAGGTAATTT TTCTGTATTG TTTCTCCCTG CAAAATGAAG CATTCTTTTC TTTCTTTGCC AGGAAGAGGA
GCTTTACGAG ATTGACATTC CCCTAAATTT TGTGGCCTCT GTTGGCACTA GGGTGCATGG GCTAGCTTGT TGGTTTGATG
TATTGTTCAA TGGGAGGTCA GTGCTATATC GGTTTATTTG AGTCTATATT GTCTCTTGTC TGCTTCTACC CGCTACAATC
TGTGTGTTTT ACTGCAGCAC TGTCCAGAGG TGGCTTACCA CTGCTCCAGG CTCCCCTACG ACTCACTGGT ATCAACTACG
ATGCATACTT TCACAGCCAT TATATGTCAT GGCAGGACAA GAAATAACAG GACGACTTCA TCTGGTAGCC CACAGTGCAC
AAAGCTACAC GATATACTTG ACGATGTCAG GTTGGGCATT TTCTATTTCG TTTGTTATCA GTTTTTTTCC CTCTATTGCA
CTTGAAGCTG ATGGTTCTTG CTCTTTTGGT TATTTTCTGG AAGCTAAAAT GTGGGGTGAG GGGGCAGAAC AAGGTGGCAT
CCTGCAGACA TCCACAGCCA AACTTGAACT CAAGGAGCCA TACTACAGGC TGTCTCAACC ACAACCATAT GTGATGCAAC
AAGACCAGCA GCAGCAGCAG TTACCATCTT TGCAGCCACA GGTAAGTTGT TTTCTATTAG GTATTTGAAG AACAACGGGG
ATGTTTGTTT AATATTTATT TTCATGCAGT ACATCTTATG CTTATATCTG CATCTTGCAT AACACTGGCA ACACCAGAAA
AATCACCATA TTATGTCTCA TTTCCTGCAA GGCACATAAT CCTGTACTTG AAGTACCTAT GTTACTGCCT ACTGTATTTG
ACTGTATGGA GACGGTTAGA TAATTGCTTA CTCTGGGCTT TTTAATCTTG TTAGTAATGT GCTTACACAA TACAACAAAC
GCGAGATAAA TATACTTCAA GTTCAAGAGT TAATATGGAA AAAATAATTA TTATTCTTAA TTTTAGAAAT TATATACATG
ACCACATAAA CAATGGGGGT TGGGCCCACC ATTCGACACA AATGCAAAGA ATACATGTTC CACAAATACT CAGTATACAC
ATGCAAAGAA ACACATGATT ACAAAATATA TTGCAGATAA CACACATGTA CATATAACTA GCCACAGAAT ATCATAATGG
GGGATGGTAT TGGTTTTAAG GAGTAAACAT CAGAAGTATT GGTATTCTTA CCTGAATTAC TTGCGAGATC TAATCGAAAC
ACATATATGC AAATGTGCGA TAATAAGTTG GTACAGGTAT TTTGATTACC AATAGTTATG TTTAATTGCA TTACAGAGTC
CTCTCTGGGA CTATCACTAC GGACAAGATT AGTTGTCTGG CCTCAGCTAT TGAACATTGG CAAGAATAGC AGGTACACAG
TTTTTAGGGT GACATACATG GAATGCTTGT TTGCAAGGCT TTTCGGAACA ATAAACTTCA TTATAAATTG AATTAAATTT
GAAAAGAGTT TTCAAAGGGC ATTTAAACTT TCAAACTGTA CTTGTTAGCA AAATTTTACT GCTGATGCAT GGACTTGATT
TTATGTATTT CCTTGATAGA TCTAACATTC GTACTGCAAA CAGGGATCTG AGCAGCAGAT GCAAGATGGT CTTAGCCCTA
GTATAACGAT TGAACCAGAC CAAGACTCGG CGGCCTTCAC TAGATAGCTC GTAAGCCGGA GTTGCTTCAG GCAAACAACT
CCAGGCCTGT ACAACAGTAT GCTCCTACCT GATGTTGCTA GGCGTTAGCT GTCAGTGGCT AACATTGCAT TCGTTGTGTA
CGAGAGGTTG TGCAGCTGTA GCTAATTGTG CTCGTGTCTG CACCGTTATT TAAAGGGGGT CAAATACAAT AAGTGTATCT
GTTTGCAGGA AAAGCTCAAC GACAAAGGCG TCTAACTAGA ACGATTGTTG TGTATGTTCT TATGTATTAT TGTTTTATTT
AATTTAAAAA TGGTTGGTCG