Os07t0673200-01

Locus

Os07g0673200

Description

RING-type E3 ubiquitin-ligase, Maintenance of phosphate homeostasis via degradation of phosphate transporters

RAP-DB Gene Symbol Synonym(s)

OsNLA1

RAP-DB Gene Name Synonym(s)

nitrogen limitation adaptation 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRFPHC-13, OsNLA, NAL, OsNLA1, NAL1

Oryzabase Gene Name Synonym(s)

RING finger protein OsRFPHC-13, RING-HC protein 13, nitrogen limitation adaptation

Transcript Evidence

AK065454

Protein Evidence

Q7XI73

Literature

PMID: 28229491

Note

Manual Curation

May 8, 2017

Functional domain (InterPro)

E3 ubiquitin-protein ligase BAH1 (IPR033326)

SPX domain (IPR004331)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Full-length cDNA

J013024P14 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0673200-01)

RiceXPro (AK065454)

Others

Oryzabase (11796)

KEGG (Os07t0673200-01 (EC:2.3.2.27))

Transcript

1693 bp

>Os07t0673200-01 RING-type E3 ubiquitin-ligase, Maintenance of phosphate homeostasis via degradation of phosphate transporters
TCGTTTCACCCTGCTCGGAAAAAAAATCCTAAAAGCTTAATTTCTTTCTTTGTTCTTATT
ACTGTCTCACGTGAGACGCCTGAGCTCAACTGAATTTCTGGCCCCCTCTTCATCTCCGTG
AGCTTCGCTGCCCTTTTTCTTTGCCTTCTCTTGGTGGTTTAATTTCATCAGTTTTCCTCC
ATTTCCTTCTTTAGCCATTGTTCCGATTGCCGTCTCTTGTTGCATGTGCATTCCTTCTCT
GAACCGTGCCCCCCCAATTCGTCCGCGAGCTATACAAATTTGGATTCGTTTTGTTCGTTT
CCAGCTCACCCTGTAAATCGTTTCTCAAGTCATTCAGGCATACTCACATCGCACAAACAT
ATATATACCCCAAGATTTTGAATCCATCAATTTGCAGACGCCATAGGCGTACAAGTTATC
CATTCAAGCGCTCCAAAAATTTGCCAAGAAGTTTGCCTTAAATTTGGATTCATGAAGTTT
GCCAAGAAGTACGAGAAGTACATGAAGGGGATGGATGAGGAGCTCCCGGGCGTGGGGCTG
AAGCGGCTCAAGAAATTGCTCAAGAAATGCCGCTCTGACCTCCAATCCCACGAGAACGAC
GGCTCCTCCGCCGGCCGCTGCCCCGGCCATTGCTCTGTATGTGATGGGAGTTTTTTCCCA
TCTCTTCTCAATGAGATGTCAGCCGTTATTGGCTGCTTCAATGAAAAGGCCAAGAAGCTT
CTCGAGTTGCACCTGGCATCAGGTTTCAAGAAATATACAATGTGGTTCACCAGCAAGGGT
CACAAGAGCCATGGGGCATTGATACAGCAAGGCAAAGACTTGGTTACTTATGCAATTATA
AATGCCGTGGCCATGAGGAAAATTTTAAAGAAATATGACAAGATACATTACTCGAAGCAA
GGGCAGGAATTCAAAGCTCAAGCCCAGAGTCTGCATATTGAAATACTTCAATCCCCATGG
CTCTGTGAGCTGATGGCTTTCTACATGAACTTGAGAAGAAGCAAGAAGAACAACGGTGCT
ATGGAGCTCTTTGGGGATTGTTCTCTCGTATTCGATGATGACAAACCAACAATTTCATGC
AACCTCTTTGACTCTATGCGTGTCGACATTAGCTTGACATGTTCGATTTGCTTGGATACC
GTGTTTGATCCAGTTGCTCTTTCCTGTGGTCACATATATTGCTACTTGTGCAGCTGTTCT
GCTGCATCCGTTACGATCGTTGATGGGCTGAAGTCTGCCGAGCGCAAATCAAAGTGCCCA
CTGTGCCGACAGGCAGGAGTCTTTCCTAATGCTGTACACTTGGATGAGCTGAACATGCTA
CTAAGCTATAGTTGTCCAGAGTACTGGGAGAAGAGAATACAGATGGAGCGGGTTGAACGT
GTTCGTCTGGCTAAGGAACACTGGGAGTCACAGTGCAGGGCATTCTTGGGCATGTGATTC
TAAAGTTGGTGGATTTTTTTTTTCTTTAGAGGGGCTTCATATGTGATGTATAGTTTCTTG
ACAAAATGGAATTTGCCATTTGTTGTCACTTATATCCTGCTCTGTTGCTCCTCTTTGTGT
AAGAAGTTGGATTTGTCATCCTAAATGCAAAAACAGCAGGGGTTGTTCACTACTGTGCAC
TTAGATGTAAATAGGGTAGATTTGTAGTCATTGTTCAAGTGCATAACTGTAAATTCATTT
ATATTTGATCAGT

CDS

966 bp

>Os07t0673200-01 RING-type E3 ubiquitin-ligase, Maintenance of phosphate homeostasis via degradation of phosphate transporters
ATGAAGTTTGCCAAGAAGTACGAGAAGTACATGAAGGGGATGGATGAGGAGCTCCCGGGC
GTGGGGCTGAAGCGGCTCAAGAAATTGCTCAAGAAATGCCGCTCTGACCTCCAATCCCAC
GAGAACGACGGCTCCTCCGCCGGCCGCTGCCCCGGCCATTGCTCTGTATGTGATGGGAGT
TTTTTCCCATCTCTTCTCAATGAGATGTCAGCCGTTATTGGCTGCTTCAATGAAAAGGCC
AAGAAGCTTCTCGAGTTGCACCTGGCATCAGGTTTCAAGAAATATACAATGTGGTTCACC
AGCAAGGGTCACAAGAGCCATGGGGCATTGATACAGCAAGGCAAAGACTTGGTTACTTAT
GCAATTATAAATGCCGTGGCCATGAGGAAAATTTTAAAGAAATATGACAAGATACATTAC
TCGAAGCAAGGGCAGGAATTCAAAGCTCAAGCCCAGAGTCTGCATATTGAAATACTTCAA
TCCCCATGGCTCTGTGAGCTGATGGCTTTCTACATGAACTTGAGAAGAAGCAAGAAGAAC
AACGGTGCTATGGAGCTCTTTGGGGATTGTTCTCTCGTATTCGATGATGACAAACCAACA
ATTTCATGCAACCTCTTTGACTCTATGCGTGTCGACATTAGCTTGACATGTTCGATTTGC
TTGGATACCGTGTTTGATCCAGTTGCTCTTTCCTGTGGTCACATATATTGCTACTTGTGC
AGCTGTTCTGCTGCATCCGTTACGATCGTTGATGGGCTGAAGTCTGCCGAGCGCAAATCA
AAGTGCCCACTGTGCCGACAGGCAGGAGTCTTTCCTAATGCTGTACACTTGGATGAGCTG
AACATGCTACTAAGCTATAGTTGTCCAGAGTACTGGGAGAAGAGAATACAGATGGAGCGG
GTTGAACGTGTTCGTCTGGCTAAGGAACACTGGGAGTCACAGTGCAGGGCATTCTTGGGC
ATGTGA

Protein

322 aa

>Os07t0673200-01 RING-type E3 ubiquitin-ligase, Maintenance of phosphate homeostasis via degradation of phosphate transporters
MKFAKKYEKYMKGMDEELPGVGLKRLKKLLKKCRSDLQSHENDGSSAGRCPGHCSVCDGS
FFPSLLNEMSAVIGCFNEKAKKLLELHLASGFKKYTMWFTSKGHKSHGALIQQGKDLVTY
AIINAVAMRKILKKYDKIHYSKQGQEFKAQAQSLHIEILQSPWLCELMAFYMNLRRSKKN
NGAMELFGDCSLVFDDDKPTISCNLFDSMRVDISLTCSICLDTVFDPVALSCGHIYCYLC
SCSAASVTIVDGLKSAERKSKCPLCRQAGVFPNAVHLDELNMLLSYSCPEYWEKRIQMER
VERVRLAKEHWESQCRAFLGM*

5'UTR

chr07:28456095..28456565 (- strand) : 471 bp

CDS

chr07:28455929..28456094 (- strand) : 166 bp

chr07:28454499..28454743 (- strand) : 245 bp

chr07:28453800..28454051 (- strand) : 252 bp

chr07:28453444..28453581 (- strand) : 138 bp

chr07:28453277..28453335 (- strand) : 59 bp

chr07:28453007..28453112 (- strand) : 106 bp

3'UTR

chr07:28452751..28453006 (- strand) : 256 bp

FASTA

>Os07t0673200-01 class=Sequence position=chr07:28452751..28456565 (- strand)
TCGTTTCACC CTGCTCGGAA AAAAAATCCT AAAAGCTTAA TTTCTTTCTT TGTTCTTATT ACTGTCTCAC GTGAGACGCC
TGAGCTCAAC TGAATTTCTG GCCCCCTCTT CATCTCCGTG AGCTTCGCTG CCCTTTTTCT TTGCCTTCTC TTGGTGGTTT
AATTTCATCA GTTTTCCTCC ATTTCCTTCT TTAGCCATTG TTCCGATTGC CGTCTCTTGT TGCATGTGCA TTCCTTCTCT
GAACCGTGCC CCCCCAATTC GTCCGCGAGC TATACAAATT TGGATTCGTT TTGTTCGTTT CCAGCTCACC CTGTAAATCG
TTTCTCAAGT CATTCAGGCA TACTCACATC GCACAAACAT ATATATACCC CAAGATTTTG AATCCATCAA TTTGCAGACG
CCATAGGCGT ACAAGTTATC CATTCAAGCG CTCCAAAAAT TTGCCAAGAA GTTTGCCTTA AATTTGGATT CATGAAGTTT
GCCAAGAAGT ACGAGAAGTA CATGAAGGGG ATGGATGAGG AGCTCCCGGG CGTGGGGCTG AAGCGGCTCA AGAAATTGCT
CAAGAAATGC CGCTCTGACC TCCAATCCCA CGAGAACGAC GGCTCCTCCG CCGGCCGCTG CCCCGGCCAT TGCTCTGGTG
AATAAAGCTA CTATACCTTT CAATTTCCTC CTATATGGTC TCTTTGATGC GTAGGACTAT TCTTGATTCT CTTACACTGA
AAATAATGCT GTTTTTTCAA AAGAAACCTG TTGGTTTCTT GTTTTCAATG AAAACGAGGA TTAATGGGCG GGCTCATGCC
TTTTGGTACT TTTTTTTTCT TTTGGTTAAA AAAGGACAAA CCCTTGGCAA AATGGCATAC CTAGAAAAGG ATTAGAATTT
AGGACTTGTT GCAACTTGCA AGAGGCAATT GTTTTTTTTT TCAGTTTTTT TAGTTTCATC GTGCTGAGAA GTGAGAAGAA
CTAGTTGATA ATTCTGCGGG AACAGAGGAA CCTGTAGGCT GTACACAGCG GTTTTGGTAT TCGGCAAGTT GAACTCTTCC
TGGGAATGCC AACCTATTTT CTCTTATTTA TCCTTTAGAT ATATGTATCC TACCTTGTTC TCGCTGTACT TCTTTTATTT
ATAGTGTCAA ACAATTACAG CTTCGCATGG AAGAGAAGCT TTACTGCAGA GAAAGCAACA ATTTGACTTC TTAGCACAAT
TCTTTCGAAG CATTTTCTCT GTCGCCCCTT GTATGGTTAA GATTGGATTT TAAAATGGCG ATAATGTTTT GTTTGCTTTC
AAACATCAAT ACCAACAAAT TAAGTTGATC GGTCGGGTAT TTGGAAAATC TGCATATACT ACTGTCGTGT GGACGGCAGA
TTTATAACAT AACTTCAAAT TGAACACTAC TAGAGATAGC CCATTGACTG CCCCATTATA ATAGTGCAAG TCATTGTCAA
GGTGGTAATT GTTTGTCAAT GACAACCACG TAATTTTTCA AGTGCCAAGA TACTATAGGC CGTAGTAACC ATGGAAAAGG
GGATGTCAAC CATCACAAAG TCCACTCTTA ATTTTGTATT CATTAGCAGG GGCTTATTCA TCTGTCCTTT TGAATAACTT
TCGATTATTT TAGTTAGTGT CGACTTGTCT ACTATAATTT GGGATGGTTT TGATATAAAT ATTTCAGAGT CCTAAAAGAG
TCGATTATTC CTGGTTCTTT CATATTGATA TTGTAACTAC TGCGGTTTGC CTAGAAAAGA ATATTAGAGT CGCCATGATG
GTTATTTTTG TCTACCTTAC CTTTCATGGT TGGTTATCTG ACAAATTCCT ATCAACATGC AGTATGTGAT GGGAGTTTTT
TCCCATCTCT TCTCAATGAG ATGTCAGCCG TTATTGGCTG CTTCAATGAA AAGGCCAAGA AGCTTCTCGA GTTGCACCTG
GCATCAGGTT TCAAGAAATA TACAATGTGG TTCACCAGCA AGGGTCACAA GAGCCATGGG GCATTGATAC AGCAAGGCAA
AGACTTGGTT ACTTATGCAA TTATAAATGC CGTGGCCATG AGGAAAATTT TAAAGAAATA TGACAAGGCA TGGCCTTAAA
CTTTAATCTT TGCACCTCTC TTTATCTCTT AAAGGCATTA GAAACATTTA AAGCTTACTA AGGACAAAGG GGGAATATTT
TTTTTTGGAA ACCGAACGAA GGGGGAAGAT AACTATATAA GTATTCCATT ATTTGAGAGA GGAACACAAA AATTTCACAC
ACTTTTAGTT ATAAGCATGT GAGTTTGGTG AAGCCCAAAA TGCTAGTCTA TATAGGTGTC AATGGGTCAT ATACTCATAT
GGTATCTTCG AGGATATATA TACACACACA CACAGAGGAT GATTGAGTTG TATTTATATA TTTAATCTTT CTAGTGACTA
TTTTTGTTAG AATTAACGTA TCTATCATTG TTCTTGTCTT TGGATTTAAG ACGGTCCTCA ATGGTTATAT TAATAATTAT
GTAAGACTAT TAACTAAAAG CCTCTCTTTT CCAGATACAT TACTCGAAGC AAGGGCAGGA ATTCAAAGCT CAAGCCCAGA
GTCTGCATAT TGAAATACTT CAATCCCCAT GGCTCTGTGA GCTGATGGCT TTCTACATGA ACTTGAGAAG AAGCAAGAAG
AACAACGGTG CTATGGAGCT CTTTGGGGAT TGTTCTCTCG TATTCGATGA TGACAAACCA ACAATTTCAT GCAACCTCTT
TGACTCTATG CGTGTCGACA TTAGCTTGAC ATGTTCGATT TGCTTGGTGA GTTTGCACTT GTCGACTGCA CCAAGATCTT
AATTTACCTA ACAAGGATAT CATTAATACA CTAAATTTTT TATGTTATGA AGTATGAATT CGTACTTAGG TTATATTCTC
CTTGTTATAA TGTGCTCAAG TATCAACTTT GTTCCTTGTT ACTGCGAAAT TCATAGCACT TCCTTATTGC ATTGTAAATT
TCTGAAATTC ACTTGCTTTT GCAGGATACC GTGTTTGATC CAGTTGCTCT TTCCTGTGGT CACATATATT GCTACTTGTG
CAGCTGTTCT GCTGCATCCG TTACGATCGT TGATGGGCTG AAGTCTGCCG AGCGCAAATC AAAGTGCCCA CTGTGCCGAC
AGGTATAAAC AATTCCTTCA ATTCGATCTT TGTTTTAGAT AACATTCCTT CAAATTTGAT GACCATATGC TTGTGCATGT
CCCATCAACT GACCTGATTT CTCATTTCAG GCAGGAGTCT TTCCTAATGC TGTACACTTG GATGAGCTGA ACATGCTACT
AAGCTATAGG TAAGTCTGAA CTGCTCAGGA TCATATCATC AGTCATCTGC ACGGCCGTAC AAATGTACAC TTTTTTTTAT
GTCATGAACA TAGATTATCA CCATATTTCG TTTATCGCAA AAGGACAAGG ATTGTTACCA AGTTGAAATT TAATATGGAT
CATCTATTGA CAGTTGTCCA GAGTACTGGG AGAAGAGAAT ACAGATGGAG CGGGTTGAAC GTGTTCGTCT GGCTAAGGAA
CACTGGGAGT CACAGTGCAG GGCATTCTTG GGCATGTGAT TCTAAAGTTG GTGGATTTTT TTTTTCTTTA GAGGGGCTTC
ATATGTGATG TATAGTTTCT TGACAAAATG GAATTTGCCA TTTGTTGTCA CTTATATCCT GCTCTGTTGC TCCTCTTTGT
GTAAGAAGTT GGATTTGTCA TCCTAAATGC AAAAACAGCA GGGGTTGTTC ACTACTGTGC ACTTAGATGT AAATAGGGTA
GATTTGTAGT CATTGTTCAA GTGCATAACT GTAAATTCAT TTATATTTGA TCAGT