Os07t0678300-01

Locus

Os07g0678300

Description

Similar to CBL-interacting protein kinase 29.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK29

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 29

Oryzabase Gene Symbol Synonym(s)

OsCIPK29, OsSnRK3.25, SnRK3.25

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 29, Sucrose nonfermenting-1-related protein kinase 3.25

Transcript Evidence

AK111746 (DDBJ, Best hit)

Protein Evidence

Q7XIW5 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

NAF domain (IPR004041)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

NAF/FISL domain (IPR018451)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J023047E15 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0678300-01)

Others

Oryzabase (7417)

Transcript

1722 bp

>Os07t0678300-01 Similar to CBL-interacting protein kinase 29.
TCCAACTCAAAACGAGCCCCCAAATCCCAGAGAGGAGTCGCGAGCTTTTCATCAATCCTC
TGATTTTCCCCCAGGTTTCCCCACCCGCAAAGAGCCTCAAAATTCCCCCTCCTCTGTCGC
GACCGATCGCGACGACGGCGCCGGACGAGCAGACACCGCCGCCACGATGCCGCCCTCCAC
CGGCTCCGTCCCACCCGCCGCATCAACGCCGGCGGCTGGGGACGAGGCCACCGCCGCCGG
GAGGGTACTCCTCGGCAGGTACGAGCTCGGCGGCCTCCTCGGCCGCGGCGcctccgccaa
ggtgtacctcgcccgcgacctcctcaccggccgcgacgtcgccatcaagtccttccccaa
cccccgccacggcggcggcctccgcggcggcgaggaggatgtcctcctccgccccgcgcc
catcgagcgggAGGCGGCCATTCTCCCCAGGCTGCGCCACCGCCACGTGATGCGCCTCCG
CGAGATTCTGGCCACGCGCAAGAAGGTCCACTTCGTCCTCGACCTCGCCGCCGGCGGCGA
GCTCTTCTCCCTGCTCGACGCGTCCGGCCGCATGACGGAGGACCTCGCGCGGCACTACTT
CCGGCAGCTCATCTCCGCCGTCCGGTACTGCCACTCCCGTGGcgtgtaccaccgcgacat
caagccggagaacctcctcctcgacgacgcgggcgacctcaaggtggccgacttcggcct
cggcgccgtcgccgacggcgccctccaccacaccctctgcggcaccccggcctacgtggc
gccggagatcctgtcgaggaaggggtacaacccagcgaaggtggacatctggtcctgcgg
cgtcgtcctcttcgtgctcgccgcggggtacctccccttcaacgacgccagcctcgtcaa
catgtaccgcaagatctacgccggcaagttccggtgcccggcctggttctcgccggagct
ccggtgcctggtccgccgcatcctggaccccaacccggcgacccgcattgacacggagga
gATCATCACCCACCCGTGGTTCCGCCAGGACGCGAGCCACTTCGCGATGGCGCAGCTGAT
GCAGCACGGCCACGACGAGGAGGCCAAATTCAAGACCGAGTTCAAGGAGGACGACATGGC
CCGGGACATGACGGCGTTCGACATACTCGCATGCTCCCCTGGCTCCGACCTCTCCGGCCT
CTTCGGCGCCGAGCCGGGGAAGGAGCGGGTGTTCGTCGGCGAGCCGGCGGCGGCGGTGCT
ATCCCGAGTGGAGGAGGCCGGGAAGAAGGAAGGGTACATGGTAACGAGAGAAGGGAAGAA
GGGCACCGGGCCGGTGTACGTGAAAGGCGAGAACGGCGGCATTGTGGCCAAGGTCTGCGT
GTTCAAGATCGCCGACGCGGTGTCCGTCGTCGAGGTGGTGAAAGGCTACGGCGCCGAGGC
CGCCCGGTTCTGGAAGGCCAGGCTCGAGCCGGCGATGAAGCCTCCGGCAGCCATCTGAGC
TGCCGACGAGAGGGTGAGCTGGTTCGTTGCCGCGTGCTTGCAAATTGCAATCGAGATTTG
TTCTTGTGTTGTTCAGTGTAACCGTGTGAGTGATGTCTCCCGTCGGCGAATTGTTTGGGT
TTTTTTGGGATGTATTTGTTCATGGACGGCGTCATGGAGGTGGTATGTAAGCACGATTTG
GTGATGTCTGGGCTGGAAAATAAGAGGCAAAAAATTCCCTGC

CDS

1332 bp

>Os07t0678300-01 Similar to CBL-interacting protein kinase 29.
ATGCCGCCCTCCACCGGCTCCGTCCCACCCGCCGCATCAACGCCGGCGGCTGGGGACGAG
GCCACCGCCGCCGGGAGGGTACTCCTCGGCAGGTACGAGCTCGGCGGCCTCCTCGGCCGC
GGCGcctccgccaaggtgtacctcgcccgcgacctcctcaccggccgcgacgtcgccatc
aagtccttccccaacccccgccacggcggcggcctccgcggcggcgaggaggatgtcctc
ctccgccccgcgcccatcgagcgggAGGCGGCCATTCTCCCCAGGCTGCGCCACCGCCAC
GTGATGCGCCTCCGCGAGATTCTGGCCACGCGCAAGAAGGTCCACTTCGTCCTCGACCTC
GCCGCCGGCGGCGAGCTCTTCTCCCTGCTCGACGCGTCCGGCCGCATGACGGAGGACCTC
GCGCGGCACTACTTCCGGCAGCTCATCTCCGCCGTCCGGTACTGCCACTCCCGTGGcgtg
taccaccgcgacatcaagccggagaacctcctcctcgacgacgcgggcgacctcaaggtg
gccgacttcggcctcggcgccgtcgccgacggcgccctccaccacaccctctgcggcacc
ccggcctacgtggcgccggagatcctgtcgaggaaggggtacaacccagcgaaggtggac
atctggtcctgcggcgtcgtcctcttcgtgctcgccgcggggtacctccccttcaacgac
gccagcctcgtcaacatgtaccgcaagatctacgccggcaagttccggtgcccggcctgg
ttctcgccggagctccggtgcctggtccgccgcatcctggaccccaacccggcgacccgc
attgacacggaggagATCATCACCCACCCGTGGTTCCGCCAGGACGCGAGCCACTTCGCG
ATGGCGCAGCTGATGCAGCACGGCCACGACGAGGAGGCCAAATTCAAGACCGAGTTCAAG
GAGGACGACATGGCCCGGGACATGACGGCGTTCGACATACTCGCATGCTCCCCTGGCTCC
GACCTCTCCGGCCTCTTCGGCGCCGAGCCGGGGAAGGAGCGGGTGTTCGTCGGCGAGCCG
GCGGCGGCGGTGCTATCCCGAGTGGAGGAGGCCGGGAAGAAGGAAGGGTACATGGTAACG
AGAGAAGGGAAGAAGGGCACCGGGCCGGTGTACGTGAAAGGCGAGAACGGCGGCATTGTG
GCCAAGGTCTGCGTGTTCAAGATCGCCGACGCGGTGTCCGTCGTCGAGGTGGTGAAAGGC
TACGGCGCCGAGGCCGCCCGGTTCTGGAAGGCCAGGCTCGAGCCGGCGATGAAGCCTCCG
GCAGCCATCTGA

Protein

443 aa

>Os07t0678300-01 Similar to CBL-interacting protein kinase 29.
MPPSTGSVPPAASTPAAGDEATAAGRVLLGRYELGGLLGRGASAKVYLARDLLTGRDVAI
KSFPNPRHGGGLRGGEEDVLLRPAPIEREAAILPRLRHRHVMRLREILATRKKVHFVLDL
AAGGELFSLLDASGRMTEDLARHYFRQLISAVRYCHSRGVYHRDIKPENLLLDDAGDLKV
ADFGLGAVADGALHHTLCGTPAYVAPEILSRKGYNPAKVDIWSCGVVLFVLAAGYLPFND
ASLVNMYRKIYAGKFRCPAWFSPELRCLVRRILDPNPATRIDTEEIITHPWFRQDASHFA
MAQLMQHGHDEEAKFKTEFKEDDMARDMTAFDILACSPGSDLSGLFGAEPGKERVFVGEP
AAAVLSRVEEAGKKEGYMVTREGKKGTGPVYVKGENGGIVAKVCVFKIADAVSVVEVVKG
YGAEAARFWKARLEPAMKPPAAI*

5'UTR

chr07:28710749..28710914 (+ strand) : 166 bp

CDS

chr07:28710915..28712246 (+ strand) : 1332 bp

3'UTR

chr07:28712247..28712470 (+ strand) : 224 bp

FASTA

>Os07t0678300-01 class=Sequence position=chr07:28710749..28712470 (+ strand)
TCCAACTCAA AACGAGCCCC CAAATCCCAG AGAGGAGTCG CGAGCTTTTC ATCAATCCTC TGATTTTCCC CCAGGTTTCC
CCACCCGCAA AGAGCCTCAA AATTCCCCCT CCTCTGTCGC GACCGATCGC GACGACGGCG CCGGACGAGC AGACACCGCC
GCCACGATGC CGCCCTCCAC CGGCTCCGTC CCACCCGCCG CATCAACGCC GGCGGCTGGG GACGAGGCCA CCGCCGCCGG
GAGGGTACTC CTCGGCAGGT ACGAGCTCGG CGGCCTCCTC GGCCGCGGCG cctccgccaa ggtgtacctc gcccgcgacc
tcctcaccgg ccgcgacgtc gccatcaagt ccttccccaa cccccgccac ggcggcggcc tccgcggcgg cgaggaggat
gtcctcctcc gccccgcgcc catcgagcgg gAGGCGGCCA TTCTCCCCAG GCTGCGCCAC CGCCACGTGA TGCGCCTCCG
CGAGATTCTG GCCACGCGCA AGAAGGTCCA CTTCGTCCTC GACCTCGCCG CCGGCGGCGA GCTCTTCTCC CTGCTCGACG
CGTCCGGCCG CATGACGGAG GACCTCGCGC GGCACTACTT CCGGCAGCTC ATCTCCGCCG TCCGGTACTG CCACTCCCGT
GGcgtgtacc accgcgacat caagccggag aacctcctcc tcgacgacgc gggcgacctc aaggtggccg acttcggcct
cggcgccgtc gccgacggcg ccctccacca caccctctgc ggcaccccgg cctacgtggc gccggagatc ctgtcgagga
aggggtacaa cccagcgaag gtggacatct ggtcctgcgg cgtcgtcctc ttcgtgctcg ccgcggggta cctccccttc
aacgacgcca gcctcgtcaa catgtaccgc aagatctacg ccggcaagtt ccggtgcccg gcctggttct cgccggagct
ccggtgcctg gtccgccgca tcctggaccc caacccggcg acccgcattg acacggagga gATCATCACC CACCCGTGGT
TCCGCCAGGA CGCGAGCCAC TTCGCGATGG CGCAGCTGAT GCAGCACGGC CACGACGAGG AGGCCAAATT CAAGACCGAG
TTCAAGGAGG ACGACATGGC CCGGGACATG ACGGCGTTCG ACATACTCGC ATGCTCCCCT GGCTCCGACC TCTCCGGCCT
CTTCGGCGCC GAGCCGGGGA AGGAGCGGGT GTTCGTCGGC GAGCCGGCGG CGGCGGTGCT ATCCCGAGTG GAGGAGGCCG
GGAAGAAGGA AGGGTACATG GTAACGAGAG AAGGGAAGAA GGGCACCGGG CCGGTGTACG TGAAAGGCGA GAACGGCGGC
ATTGTGGCCA AGGTCTGCGT GTTCAAGATC GCCGACGCGG TGTCCGTCGT CGAGGTGGTG AAAGGCTACG GCGCCGAGGC
CGCCCGGTTC TGGAAGGCCA GGCTCGAGCC GGCGATGAAG CCTCCGGCAG CCATCTGAGC TGCCGACGAG AGGGTGAGCT
GGTTCGTTGC CGCGTGCTTG CAAATTGCAA TCGAGATTTG TTCTTGTGTT GTTCAGTGTA ACCGTGTGAG TGATGTCTCC
CGTCGGCGAA TTGTTTGGGT TTTTTTGGGA TGTATTTGTT CATGGACGGC GTCATGGAGG TGGTATGTAA GCACGATTTG
GTGATGTCTG GGCTGGAAAA TAAGAGGCAA AAAATTCCCT GC

Locus: Os07g0678300

Loading...

Locus: Os07g0678300

Loading...