Os07t0678600-01

Locus

Os07g0678600

Description

Calcineurin B-like protein interacting protein kinase

RAP-DB Gene Symbol Synonym(s)

OsCIPK2

RAP-DB Gene Name Synonym(s)

Calcineurin B-like interacting protein kinase 2

CGSNL Gene Symbol

CIPK02

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 2

Oryzabase Gene Symbol Synonym(s)

OsCIPK02, CIPK2, OsCIPK2, OsSnRK3.26, SnRK3.26

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 2, Sucrose nonfermenting-1-related protein kinase 3.26

Transcript Evidence

AK072868

Protein Evidence

Q7X996

Literature

PMID: 31349588

Note

Manual Curation

July 29, 2019

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

NAF/FISL domain (IPR018451)

NAF domain (IPR004041)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J023141O10 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0678600-01)

RiceXPro (AK072868)

Others

Oryzabase (7389)

KEGG (Os07t0678600-01 (EC:2.7.11.1))

Transcript

2106 bp

>Os07t0678600-01 Calcineurin B-like protein interacting protein kinase
ATTGCTGCGCCGTGCTCGAACAGATCTCGATCTCGATCTCGATCTCCGCACGCACCAAGG
CGAAGCCAATTCCACTACCACCGCTCTTCCTTCTTCTCACTCCTTCTCGCGACTGCGGCG
AGGGTGAGTCTCCTGTCGTGAGAATTTCGGTCTACCGGCGGCGGCGGCGGCGTTGGGTGT
TCTTCGCGTCGTCAGACGTCGGGATCTGAATTACTAGACTTCCAATAAGAAGGAAACACC
TTAGGGAATGCAGAAAGATGTGCTTGCATGCTAGAGAGCTACCTTGTGAGGGAATTGGCA
GGGTAGCAAGCCATATTTCTCCTTCCACAACTCTTCATGACATTGGAACACAAGAGTATA
TACAGCGCTTGCTCCATGTGCTCTCGCACTATGGGGTTCGACGTGGCAACTCAACCATCT
TCTTAGATCACCATCTTGGTGGAGACGGTTGAAGTCACCTATCATTTCTAGGCTCCTGGT
TACCACACTTTGAGCTTTGGGATTACTGCTTTCTTTGGCGTGATGGCGGAGCAGAGAGGA
AATATGTTGATGAAAAAGTATGAGATGGGGAAATTACTCGGGCAAGGAACCTTTGCCAAG
GTTTACCATGCCCGTAACACCGAGACTTCTGAGAGTGTTGCTATCAAGATGATTGATAAA
GAGAAGGTTTTGAAAGGCGGGCTCATGGATCAGATCAAACGTGAGATTTCTGTGATGAAG
TTGGTGAGGCATCCAAACATTGTGCAGTTATATGAGGTCATGGCTACCAAGACtaagata
tattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaaga
ctaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgc
cacagcaggggtgtttatcaccgtgatttgaagccagaAAATCTTCTTCTTGATGAGAAC
AGCAATCTGAAGGTTTCAGATTTTGGCCTAAGTGCTCTTGCTGATTGCAAAAGACAGGAT
GGGCTGCTCCACACAACCTGTGGCACACCTGCTTATGTTGCTCCAGAAGTGATCAACAGA
AGAGGCTATGACGGTGCTAAGGCTGACATATGGTCTTGTGGAGTGATACTCTTTGTGCTA
TTGGCCGGCTATCTACCTTTCCATGATAAGAACTTGATGGATATGTATAAGAAGATTGGG
AAAGCAGAATTCAAATGTCCAAGTTGGTTTAATACCGATGTTCGAAGGCTCTTGCTCAGG
ATACTTGATCCTAACCCAAGTACAAGGATCTCAATGGACAAAATCATGGAAAATCCTTGG
TTTAGGAAGGGTCTCGATGCAAAGCTGCTCAGATATAATCTACAACCAAAGGATGCAATT
CCTGTTGATATGAGCACAGATTTTGACTCCTTCAATAGCGCTCCAACATTGGAGAAGAAG
CCGTCCAACTTGAATGCTTTTGATATAATTTCTTTGTCAACTGGACTTGACCTCTCTGGT
ATGTTTGAGGAGTCTGATAAGAAAGAGTCCAAATTCACATCCACCAGTACAGCTTCAACA
ATCATATCTAAGATTGAGGATATTGCCAAGGGCTTGCGGTTGAAGCTCACAAAGAAAGAT
GGTGGACTGTTGAAGATGGAAGGCTCCAAGCCTGGAAGGAAAGGTGTTATGGGCATTGAT
GCAGAGATATTCGAGGTTACCCCAAACTTTCATCTTGTGGAGCTAAAGAAGACAAATGGT
GATACACTTGAATACCGTAAGGTCTTGAACCAAGAGATGAGACCAGCTTTGAAGGACATA
GTCTGGGCTTGGCAGGGTGAGCAACCGAAGCAGCAGCAGCAGCCAACGTGCTAAAAAACT
TTGACAAGGGCAAGTTTTTTGCAATTTGAGTCGACTTCCAATCGTTTATGTATTTCTGCA
GCTTTTGTTCCTCTTGTTATTCATTTTCATTCCTCATGTATTGTTAATATTAATATCGAT
GCTATCTTCAAATGAGGATTTATTTGAAAAAAATGTTGAGTTTGTTTCTGGATGTTACTG
TTTTTGCTCATGGAGAACTGTAATACTGACATTTTTCATTTATCATGACGCAAAAAGATG
CATATT

CDS

1332 bp

>Os07t0678600-01 Calcineurin B-like protein interacting protein kinase
ATGGCGGAGCAGAGAGGAAATATGTTGATGAAAAAGTATGAGATGGGGAAATTACTCGGG
CAAGGAACCTTTGCCAAGGTTTACCATGCCCGTAACACCGAGACTTCTGAGAGTGTTGCT
ATCAAGATGATTGATAAAGAGAAGGTTTTGAAAGGCGGGCTCATGGATCAGATCAAACGT
GAGATTTCTGTGATGAAGTTGGTGAGGCATCCAAACATTGTGCAGTTATATGAGGTCATG
GCTACCAAGACtaagatatattttgtgctggagcacgtcaaaggtggagagttgttcaac
aaagttcagagaggaagactaaaggaagatgcagcaaggaagtacttccaacaactgatt
tgcgctgttgacttttgccacagcaggggtgtttatcaccgtgatttgaagccagaAAAT
CTTCTTCTTGATGAGAACAGCAATCTGAAGGTTTCAGATTTTGGCCTAAGTGCTCTTGCT
GATTGCAAAAGACAGGATGGGCTGCTCCACACAACCTGTGGCACACCTGCTTATGTTGCT
CCAGAAGTGATCAACAGAAGAGGCTATGACGGTGCTAAGGCTGACATATGGTCTTGTGGA
GTGATACTCTTTGTGCTATTGGCCGGCTATCTACCTTTCCATGATAAGAACTTGATGGAT
ATGTATAAGAAGATTGGGAAAGCAGAATTCAAATGTCCAAGTTGGTTTAATACCGATGTT
CGAAGGCTCTTGCTCAGGATACTTGATCCTAACCCAAGTACAAGGATCTCAATGGACAAA
ATCATGGAAAATCCTTGGTTTAGGAAGGGTCTCGATGCAAAGCTGCTCAGATATAATCTA
CAACCAAAGGATGCAATTCCTGTTGATATGAGCACAGATTTTGACTCCTTCAATAGCGCT
CCAACATTGGAGAAGAAGCCGTCCAACTTGAATGCTTTTGATATAATTTCTTTGTCAACT
GGACTTGACCTCTCTGGTATGTTTGAGGAGTCTGATAAGAAAGAGTCCAAATTCACATCC
ACCAGTACAGCTTCAACAATCATATCTAAGATTGAGGATATTGCCAAGGGCTTGCGGTTG
AAGCTCACAAAGAAAGATGGTGGACTGTTGAAGATGGAAGGCTCCAAGCCTGGAAGGAAA
GGTGTTATGGGCATTGATGCAGAGATATTCGAGGTTACCCCAAACTTTCATCTTGTGGAG
CTAAAGAAGACAAATGGTGATACACTTGAATACCGTAAGGTCTTGAACCAAGAGATGAGA
CCAGCTTTGAAGGACATAGTCTGGGCTTGGCAGGGTGAGCAACCGAAGCAGCAGCAGCAG
CCAACGTGCTAA

Protein

443 aa

>Os07t0678600-01 Calcineurin B-like protein interacting protein kinase
MAEQRGNMLMKKYEMGKLLGQGTFAKVYHARNTETSESVAIKMIDKEKVLKGGLMDQIKR
EISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLI
CAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVA
PEVINRRGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIGKAEFKCPSWFNTDV
RRLLLRILDPNPSTRISMDKIMENPWFRKGLDAKLLRYNLQPKDAIPVDMSTDFDSFNSA
PTLEKKPSNLNAFDIISLSTGLDLSGMFEESDKKESKFTSTSTASTIISKIEDIAKGLRL
KLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEVTPNFHLVELKKTNGDTLEYRKVLNQEMR
PALKDIVWAWQGEQPKQQQQPTC*

5'UTR

chr07:28729320..28729527 (- strand) : 208 bp

chr07:28728401..28728714 (- strand) : 314 bp

CDS

chr07:28727069..28728400 (- strand) : 1332 bp

3'UTR

chr07:28726817..28727068 (- strand) : 252 bp

FASTA

>Os07t0678600-01 class=Sequence position=chr07:28726817..28729527 (- strand)
ATTGCTGCGC CGTGCTCGAA CAGATCTCGA TCTCGATCTC GATCTCCGCA CGCACCAAGG CGAAGCCAAT TCCACTACCA
CCGCTCTTCC TTCTTCTCAC TCCTTCTCGC GACTGCGGCG AGGGTGAGTC TCCTGTCGTG AGAATTTCGG TCTACCGGCG
GCGGCGGCGG CGTTGGGTGT TCTTCGCGTC GTCAGACGTC GGGATCTGGT ACGGTTCTCC TTATCTCTGG TTGTTGATAA
TCTATATGGA TCTATGGTTT GTTGATTCGT CTGTATGTGA AAAACATCAT CTTGGGTTAG CGAGGGGTGG GTTTCAGATT
CTCAGGTCGA GTCTCCAGTA CACTGGTTGA GTGCTCGTTT CTAGATCTGT ATTTGTTCTG CAACGCGAGG TGTTGTGGTT
GATGCGATTC ATGCGAAAAC TTAATCTGTC ATACATACTT GGAAGGGTAA AAAAAGAAAA AAATAATCTC CTTTCTACTG
GAGATGCATA GCGTGGGAAT TATAATTAGC CTCTTGTTAT CTGCTAGCCT GGTTGTTGAG CGAAGCTTTC GGATCCAACC
TTTTAATTCA GGGTAGCTTT ATGTAGTACA GAAAACTGTG TAACTGTATT GTGTTTCCTG TTACTTTCTT TTAAAACAAG
TTCTGGTTGA AAAGCGTAGA AACAGTCTTA ACTGGCATGT CTTGTTTTCA TGCATATGTG CTGTGCAGTA GATTAATCCT
TTTACCTAGA ACTTCTCAAT TGAGTTTTAT GTTAGTTGAT TCCAACTAGT AGTTGTCCAT GACTGACCTT ATTGCATCTT
CTTCTTTTGG CAGAATTACT AGACTTCCAA TAAGAAGGAA ACACCTTAGG GAATGCAGAA AGATGTGCTT GCATGCTAGA
GAGCTACCTT GTGAGGGAAT TGGCAGGGTA GCAAGCCATA TTTCTCCTTC CACAACTCTT CATGACATTG GAACACAAGA
GTATATACAG CGCTTGCTCC ATGTGCTCTC GCACTATGGG GTTCGACGTG GCAACTCAAC CATCTTCTTA GATCACCATC
TTGGTGGAGA CGGTTGAAGT CACCTATCAT TTCTAGGCTC CTGGTTACCA CACTTTGAGC TTTGGGATTA CTGCTTTCTT
TGGCGTGATG GCGGAGCAGA GAGGAAATAT GTTGATGAAA AAGTATGAGA TGGGGAAATT ACTCGGGCAA GGAACCTTTG
CCAAGGTTTA CCATGCCCGT AACACCGAGA CTTCTGAGAG TGTTGCTATC AAGATGATTG ATAAAGAGAA GGTTTTGAAA
GGCGGGCTCA TGGATCAGAT CAAACGTGAG ATTTCTGTGA TGAAGTTGGT GAGGCATCCA AACATTGTGC AGTTATATGA
GGTCATGGCT ACCAAGACta agatatattt tgtgctggag cacgtcaaag gtggagagtt gttcaacaaa gttcagagag
gaagactaaa ggaagatgca gcaaggaagt acttccaaca actgatttgc gctgttgact tttgccacag caggggtgtt
tatcaccgtg atttgaagcc agaAAATCTT CTTCTTGATG AGAACAGCAA TCTGAAGGTT TCAGATTTTG GCCTAAGTGC
TCTTGCTGAT TGCAAAAGAC AGGATGGGCT GCTCCACACA ACCTGTGGCA CACCTGCTTA TGTTGCTCCA GAAGTGATCA
ACAGAAGAGG CTATGACGGT GCTAAGGCTG ACATATGGTC TTGTGGAGTG ATACTCTTTG TGCTATTGGC CGGCTATCTA
CCTTTCCATG ATAAGAACTT GATGGATATG TATAAGAAGA TTGGGAAAGC AGAATTCAAA TGTCCAAGTT GGTTTAATAC
CGATGTTCGA AGGCTCTTGC TCAGGATACT TGATCCTAAC CCAAGTACAA GGATCTCAAT GGACAAAATC ATGGAAAATC
CTTGGTTTAG GAAGGGTCTC GATGCAAAGC TGCTCAGATA TAATCTACAA CCAAAGGATG CAATTCCTGT TGATATGAGC
ACAGATTTTG ACTCCTTCAA TAGCGCTCCA ACATTGGAGA AGAAGCCGTC CAACTTGAAT GCTTTTGATA TAATTTCTTT
GTCAACTGGA CTTGACCTCT CTGGTATGTT TGAGGAGTCT GATAAGAAAG AGTCCAAATT CACATCCACC AGTACAGCTT
CAACAATCAT ATCTAAGATT GAGGATATTG CCAAGGGCTT GCGGTTGAAG CTCACAAAGA AAGATGGTGG ACTGTTGAAG
ATGGAAGGCT CCAAGCCTGG AAGGAAAGGT GTTATGGGCA TTGATGCAGA GATATTCGAG GTTACCCCAA ACTTTCATCT
TGTGGAGCTA AAGAAGACAA ATGGTGATAC ACTTGAATAC CGTAAGGTCT TGAACCAAGA GATGAGACCA GCTTTGAAGG
ACATAGTCTG GGCTTGGCAG GGTGAGCAAC CGAAGCAGCA GCAGCAGCCA ACGTGCTAAA AAACTTTGAC AAGGGCAAGT
TTTTTGCAAT TTGAGTCGAC TTCCAATCGT TTATGTATTT CTGCAGCTTT TGTTCCTCTT GTTATTCATT TTCATTCCTC
ATGTATTGTT AATATTAATA TCGATGCTAT CTTCAAATGA GGATTTATTT GAAAAAAATG TTGAGTTTGT TTCTGGATGT
TACTGTTTTT GCTCATGGAG AACTGTAATA CTGACATTTT TCATTTATCA TGACGCAAAA AGATGCATAT T

Locus: Os07g0678600

Loading...

Locus: Os07g0678600

Loading...