Os07t0678600-02

Locus

Os07g0678600

Description

Similar to cDNA clone:J023141O10, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK02

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 2

Oryzabase Gene Symbol Synonym(s)

OsCIPK02, CIPK2, OsCIPK2, OsSnRK3.26, SnRK3.26

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 2, Sucrose nonfermenting-1-related protein kinase 3.26

Transcript Evidence

AK058819 (DDBJ, Best hit)

Protein Evidence

B3GLZ6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

NAF domain (IPR004041)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

NAF/FISL domain (IPR018451)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Calcium/calmodulin-dependent/calcium-dependent protein kinase (IPR020636)

Full-length cDNA

001-003-G04 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0678600-02)

RiceXPro (AK058819)

Others

Oryzabase (7389)

KEGG (Os07t0678600-02 (EC:2.7.11.1))

Transcript

1283 bp

>Os07t0678600-02 Similar to cDNA clone:J023141O10, full insert sequence.
TTGAAAGGCGGGCTCATGGATCAGATCAAACGTGAGATTTCTGTGATGAAGTTGGTGAGG
CATCCAAACATTGTGCAGTTATATGAGGTCATGGCTACCAAGACtaagatatattttgtg
ctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaagactaaaggaa
gatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgccacagcagg
ggtgtttatcaccgtgatttgaagccagaAAATCTTCTTCTTGATGAGAACAGCAATCTG
AAGGTTTCAGATTTTGGCCTAAGTGCTCTTGCTGATTGCAAAAGACAGGATGGGCTGCTC
CACACAACCTGTGGCACACCTGCTTATGTTGCTCCAGAAGTGATCAACAGAAGAGGCTAT
GACGGTGCTAAGGCTGACATATGGTCTTGTGGAGTGATACTCTTTGTGCTATTGGCCGGC
TATCTACCTTTCCATGATAAGAACTTGATGGATATGTATAAGAAGATTGGGAAAGCAGAA
TTCAAATGTCCAAGTTGGTTTAATACCGATGTTCGAAGGCTCTTGCTCAGGATACTTGAT
CCTAACCCAAGTACAAGGATCTCAATGGACAAAATCATGGAAAATCCTTGGTTTAGGAAG
GGTCTCGATGCAAAGCTGCTCAGATATAATCTACAACCAAAGGATGCAATTCCTGTTGAT
ATGAGCACAGATTTTGACTCCTTCAATAGCGCTCCAACATTGGAGAAGAAGCCGTCCAAC
TTGAATGCTTTTGATATAATTTCTTTGTCAACTGGACTTGACCTCTCTGGTATGTTTGAG
GAGTCTGATAAGAAAGAGTCCAAATTCACATCCACCAGTACAGCTTCAACAATCATATCT
AAGATTGAGGATATTGCCAAGGGCTTGCGGTTGAAGCTCACAAAGAAAGATGGTGGACTG
TTGAAGATGGAAGGCTCCAAGCCTGGAAGGAAAGGTGTTATGGGCATTGATGCAGAGATA
TTCGAGGTTACCCCAAACTTTCATCTTGTGGAGCTAAAGAAACACTTGAATACCGTAAGG
TCTTGAACCAAGAGATGAGACCAGCTTTGAAGGACATAGTCTGGGCTTGGCAGGGTGAGC
AACCGAAGCAGCAGCAGCAGCCAACGTGCTAAAAAACTTTGACAAGGGCAAGTTTTTTGC
AATTTGAGTCGACTTCCAATCGTTTATGTATTTCTGCAGCTTTTGTTCCTCTTGTTATTC
ATTTTCATTCCTCATGTATTGTT

CDS

1086 bp

>Os07t0678600-02 Similar to cDNA clone:J023141O10, full insert sequence.
TTGAAAGGCGGGCTCATGGATCAGATCAAACGTGAGATTTCTGTGATGAAGTTGGTGAGG
CATCCAAACATTGTGCAGTTATATGAGGTCATGGCTACCAAGACtaagatatattttgtg
ctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaagactaaaggaa
gatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgccacagcagg
ggtgtttatcaccgtgatttgaagccagaAAATCTTCTTCTTGATGAGAACAGCAATCTG
AAGGTTTCAGATTTTGGCCTAAGTGCTCTTGCTGATTGCAAAAGACAGGATGGGCTGCTC
CACACAACCTGTGGCACACCTGCTTATGTTGCTCCAGAAGTGATCAACAGAAGAGGCTAT
GACGGTGCTAAGGCTGACATATGGTCTTGTGGAGTGATACTCTTTGTGCTATTGGCCGGC
TATCTACCTTTCCATGATAAGAACTTGATGGATATGTATAAGAAGATTGGGAAAGCAGAA
TTCAAATGTCCAAGTTGGTTTAATACCGATGTTCGAAGGCTCTTGCTCAGGATACTTGAT
CCTAACCCAAGTACAAGGATCTCAATGGACAAAATCATGGAAAATCCTTGGTTTAGGAAG
GGTCTCGATGCAAAGCTGCTCAGATATAATCTACAACCAAAGGATGCAATTCCTGTTGAT
ATGAGCACAGATTTTGACTCCTTCAATAGCGCTCCAACATTGGAGAAGAAGCCGTCCAAC
TTGAATGCTTTTGATATAATTTCTTTGTCAACTGGACTTGACCTCTCTGGTATGTTTGAG
GAGTCTGATAAGAAAGAGTCCAAATTCACATCCACCAGTACAGCTTCAACAATCATATCT
AAGATTGAGGATATTGCCAAGGGCTTGCGGTTGAAGCTCACAAAGAAAGATGGTGGACTG
TTGAAGATGGAAGGCTCCAAGCCTGGAAGGAAAGGTGTTATGGGCATTGATGCAGAGATA
TTCGAGGTTACCCCAAACTTTCATCTTGTGGAGCTAAAGAAACACTTGAATACCGTAAGG
TCTTGA

Protein

361 aa

>Os07t0678600-02 Similar to cDNA clone:J023141O10, full insert sequence.
LKGGLMDQIKREISVMKLVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKE
DAARKYFQQLICAVDFCHSRGVYHRDLKPENLLLDENSNLKVSDFGLSALADCKRQDGLL
HTTCGTPAYVAPEVINRRGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIGKAE
FKCPSWFNTDVRRLLLRILDPNPSTRISMDKIMENPWFRKGLDAKLLRYNLQPKDAIPVD
MSTDFDSFNSAPTLEKKPSNLNAFDIISLSTGLDLSGMFEESDKKESKFTSTSTASTIIS
KIEDIAKGLRLKLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEVTPNFHLVELKKHLNTVR
S*

CDS

chr07:28727193..28728253 (- strand) : 1061 bp

chr07:28727155..28727179 (- strand) : 25 bp

3'UTR

chr07:28726958..28727154 (- strand) : 197 bp

FASTA

>Os07t0678600-02 class=Sequence position=chr07:28726958..28728253 (- strand)
TTGAAAGGCG GGCTCATGGA TCAGATCAAA CGTGAGATTT CTGTGATGAA GTTGGTGAGG CATCCAAACA TTGTGCAGTT
ATATGAGGTC ATGGCTACCA AGACtaagat atattttgtg ctggagcacg tcaaaggtgg agagttgttc aacaaagttc
agagaggaag actaaaggaa gatgcagcaa ggaagtactt ccaacaactg atttgcgctg ttgacttttg ccacagcagg
ggtgtttatc accgtgattt gaagccagaA AATCTTCTTC TTGATGAGAA CAGCAATCTG AAGGTTTCAG ATTTTGGCCT
AAGTGCTCTT GCTGATTGCA AAAGACAGGA TGGGCTGCTC CACACAACCT GTGGCACACC TGCTTATGTT GCTCCAGAAG
TGATCAACAG AAGAGGCTAT GACGGTGCTA AGGCTGACAT ATGGTCTTGT GGAGTGATAC TCTTTGTGCT ATTGGCCGGC
TATCTACCTT TCCATGATAA GAACTTGATG GATATGTATA AGAAGATTGG GAAAGCAGAA TTCAAATGTC CAAGTTGGTT
TAATACCGAT GTTCGAAGGC TCTTGCTCAG GATACTTGAT CCTAACCCAA GTACAAGGAT CTCAATGGAC AAAATCATGG
AAAATCCTTG GTTTAGGAAG GGTCTCGATG CAAAGCTGCT CAGATATAAT CTACAACCAA AGGATGCAAT TCCTGTTGAT
ATGAGCACAG ATTTTGACTC CTTCAATAGC GCTCCAACAT TGGAGAAGAA GCCGTCCAAC TTGAATGCTT TTGATATAAT
TTCTTTGTCA ACTGGACTTG ACCTCTCTGG TATGTTTGAG GAGTCTGATA AGAAAGAGTC CAAATTCACA TCCACCAGTA
CAGCTTCAAC AATCATATCT AAGATTGAGG ATATTGCCAA GGGCTTGCGG TTGAAGCTCA CAAAGAAAGA TGGTGGACTG
TTGAAGATGG AAGGCTCCAA GCCTGGAAGG AAAGGTGTTA TGGGCATTGA TGCAGAGATA TTCGAGGTTA CCCCAAACTT
TCATCTTGTG GAGCTAAAGA AGACAAATGG TGATACACTT GAATACCGTA AGGTCTTGAA CCAAGAGATG AGACCAGCTT
TGAAGGACAT AGTCTGGGCT TGGCAGGGTG AGCAACCGAA GCAGCAGCAG CAGCCAACGT GCTAAAAAAC TTTGACAAGG
GCAAGTTTTT TGCAATTTGA GTCGACTTCC AATCGTTTAT GTATTTCTGC AGCTTTTGTT CCTCTTGTTA TTCATTTTCA
TTCCTCATGT ATTGTT

Locus: Os07g0678600

Loading...

Locus: Os07g0678600

Loading...