Os07t0678600-03

Locus

Os07g0678600

Description

Similar to cDNA clone:J023141O10, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK02

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 2

Oryzabase Gene Symbol Synonym(s)

OsCIPK02, CIPK2, OsCIPK2, OsSnRK3.26, SnRK3.26

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 2, Sucrose nonfermenting-1-related protein kinase 3.26

Transcript Evidence

AK059418 (DDBJ, Best hit)

Protein Evidence

B3GLZ6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

NAF domain (IPR004041)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Calcium/calmodulin-dependent/calcium-dependent protein kinase (IPR020636)

Full-length cDNA

001-027-D08 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0678600-03)

RiceXPro (AK059418)

Others

Oryzabase (7389)

KEGG (Os07t0678600-03 (EC:2.7.11.1))

Transcript

1229 bp

>Os07t0678600-03 Similar to cDNA clone:J023141O10, full insert sequence.
AGTTGGTGAGGCATCCAAACATTGTGCAGTTATATGAGGTCATGGCTACCAAGACtaaga
tatattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaa
gactaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgactttt
gccacagcaggggtgtttatcaccgtgatttgaagccagaAAATCTTCTTCTTGATGAGA
ACAGCAATCTGAAGGTTTCAGATTTTGGCCTAAGTGCTCTTGCTGATTGCAAAAGACAGG
ATGGGCTGCTCCACACAACCTGTGGCACACCTGCTTATGTTGCTCCAGAAGTGATCAACA
GAAGAGGCTATGACGGTGCTAAGGCTGACATATGGTCTTGTGGAGTGATACTCTTTGTGC
TATTGGCCGGCTATCTACCTTTCCATGATAAGAACTTGATGGATATGTATAAGAAGATTG
GGAAAGCAGAATTCAAATGTCCAAGTTGGTTTAATACCGATGTTCGAAGGCTCTTGCTCA
GGATACTTGATCCTAACCCAAGTACAAGGATCTCAATGGACAAAATCATGGAAAATCCTT
GGTTTAGGAAGGGTCTCGATGCAAAGCTGCTCAGATATAATCTACAACCAAAGGATGCTG
ATATAATTTCTTTGTCAACTGGACTTGACCTCTCTGGTATGTTTGAGGAGTCTGATAAGA
AAGAGTCCAAATTCACATCCACCAGTACAGCTTCAACAATCATATCTAAGATTGAGGATA
TTGCCAAGGGCTTGCGGTTGAAGCTCACAAAGAAAGATGGTGGACTGTTGAAGATGGAAG
GCTCCAAGCCTGGAAGGAAAGGTGTTATGGGCATTGATGCAGAGATATTCGAGGTTACCC
CAAACTTTCATCTTGTGGAGCTAAAGAAGACAAATGGTGATACACTTGAATACCGTAAGG
TCTTGAACCAAGAGATGAGACCAGCTTTGAAGGACATAGTCTGGGCTTGGCAGGGTGAGC
AACCGAAGCAGCAGCAGCAGCCAACGTGCTAAAAAACTTTGACAAGGGCAAGTTTTTTGC
AATTTGAGTCGACTTCCAATCGTTTATGTATTTCTGCAGCTTTTGTTCCTCTTGTTATTC
ATTTTCATTCCTCATGTATTGTTAATATTAATATCGATGCTATCTTCAAATGAGGATTTA
TTTGAAAAAAATGTTGAGTTTGTTTCTGG

CDS

1050 bp

>Os07t0678600-03 Similar to cDNA clone:J023141O10, full insert sequence.
TTGGTGAGGCATCCAAACATTGTGCAGTTATATGAGGTCATGGCTACCAAGACtaagata
tattttgtgctggagcacgtcaaaggtggagagttgttcaacaaagttcagagaggaaga
ctaaaggaagatgcagcaaggaagtacttccaacaactgatttgcgctgttgacttttgc
cacagcaggggtgtttatcaccgtgatttgaagccagaAAATCTTCTTCTTGATGAGAAC
AGCAATCTGAAGGTTTCAGATTTTGGCCTAAGTGCTCTTGCTGATTGCAAAAGACAGGAT
GGGCTGCTCCACACAACCTGTGGCACACCTGCTTATGTTGCTCCAGAAGTGATCAACAGA
AGAGGCTATGACGGTGCTAAGGCTGACATATGGTCTTGTGGAGTGATACTCTTTGTGCTA
TTGGCCGGCTATCTACCTTTCCATGATAAGAACTTGATGGATATGTATAAGAAGATTGGG
AAAGCAGAATTCAAATGTCCAAGTTGGTTTAATACCGATGTTCGAAGGCTCTTGCTCAGG
ATACTTGATCCTAACCCAAGTACAAGGATCTCAATGGACAAAATCATGGAAAATCCTTGG
TTTAGGAAGGGTCTCGATGCAAAGCTGCTCAGATATAATCTACAACCAAAGGATGCTGAT
ATAATTTCTTTGTCAACTGGACTTGACCTCTCTGGTATGTTTGAGGAGTCTGATAAGAAA
GAGTCCAAATTCACATCCACCAGTACAGCTTCAACAATCATATCTAAGATTGAGGATATT
GCCAAGGGCTTGCGGTTGAAGCTCACAAAGAAAGATGGTGGACTGTTGAAGATGGAAGGC
TCCAAGCCTGGAAGGAAAGGTGTTATGGGCATTGATGCAGAGATATTCGAGGTTACCCCA
AACTTTCATCTTGTGGAGCTAAAGAAGACAAATGGTGATACACTTGAATACCGTAAGGTC
TTGAACCAAGAGATGAGACCAGCTTTGAAGGACATAGTCTGGGCTTGGCAGGGTGAGCAA
CCGAAGCAGCAGCAGCAGCCAACGTGCTAA

Protein

349 aa

>Os07t0678600-03 Similar to cDNA clone:J023141O10, full insert sequence.
LVRHPNIVQLYEVMATKTKIYFVLEHVKGGELFNKVQRGRLKEDAARKYFQQLICAVDFC
HSRGVYHRDLKPENLLLDENSNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINR
RGYDGAKADIWSCGVILFVLLAGYLPFHDKNLMDMYKKIGKAEFKCPSWFNTDVRRLLLR
ILDPNPSTRISMDKIMENPWFRKGLDAKLLRYNLQPKDADIISLSTGLDLSGMFEESDKK
ESKFTSTSTASTIISKIEDIAKGLRLKLTKKDGGLLKMEGSKPGRKGVMGIDAEIFEVTP
NFHLVELKKTNGDTLEYRKVLNQEMRPALKDIVWAWQGEQPKQQQQPTC*

5'UTR

chr07:28728203..28728204 (- strand) : 2 bp

CDS

chr07:28727547..28728202 (- strand) : 656 bp

chr07:28727069..28727462 (- strand) : 394 bp

3'UTR

chr07:28726892..28727068 (- strand) : 177 bp

FASTA

>Os07t0678600-03 class=Sequence position=chr07:28726892..28728204 (- strand)
AGTTGGTGAG GCATCCAAAC ATTGTGCAGT TATATGAGGT CATGGCTACC AAGACtaaga tatattttgt gctggagcac
gtcaaaggtg gagagttgtt caacaaagtt cagagaggaa gactaaagga agatgcagca aggaagtact tccaacaact
gatttgcgct gttgactttt gccacagcag gggtgtttat caccgtgatt tgaagccaga AAATCTTCTT CTTGATGAGA
ACAGCAATCT GAAGGTTTCA GATTTTGGCC TAAGTGCTCT TGCTGATTGC AAAAGACAGG ATGGGCTGCT CCACACAACC
TGTGGCACAC CTGCTTATGT TGCTCCAGAA GTGATCAACA GAAGAGGCTA TGACGGTGCT AAGGCTGACA TATGGTCTTG
TGGAGTGATA CTCTTTGTGC TATTGGCCGG CTATCTACCT TTCCATGATA AGAACTTGAT GGATATGTAT AAGAAGATTG
GGAAAGCAGA ATTCAAATGT CCAAGTTGGT TTAATACCGA TGTTCGAAGG CTCTTGCTCA GGATACTTGA TCCTAACCCA
AGTACAAGGA TCTCAATGGA CAAAATCATG GAAAATCCTT GGTTTAGGAA GGGTCTCGAT GCAAAGCTGC TCAGATATAA
TCTACAACCA AAGGATGCAA TTCCTGTTGA TATGAGCACA GATTTTGACT CCTTCAATAG CGCTCCAACA TTGGAGAAGA
AGCCGTCCAA CTTGAATGCT TTTGATATAA TTTCTTTGTC AACTGGACTT GACCTCTCTG GTATGTTTGA GGAGTCTGAT
AAGAAAGAGT CCAAATTCAC ATCCACCAGT ACAGCTTCAA CAATCATATC TAAGATTGAG GATATTGCCA AGGGCTTGCG
GTTGAAGCTC ACAAAGAAAG ATGGTGGACT GTTGAAGATG GAAGGCTCCA AGCCTGGAAG GAAAGGTGTT ATGGGCATTG
ATGCAGAGAT ATTCGAGGTT ACCCCAAACT TTCATCTTGT GGAGCTAAAG AAGACAAATG GTGATACACT TGAATACCGT
AAGGTCTTGA ACCAAGAGAT GAGACCAGCT TTGAAGGACA TAGTCTGGGC TTGGCAGGGT GAGCAACCGA AGCAGCAGCA
GCAGCCAACG TGCTAAAAAA CTTTGACAAG GGCAAGTTTT TTGCAATTTG AGTCGACTTC CAATCGTTTA TGTATTTCTG
CAGCTTTTGT TCCTCTTGTT ATTCATTTTC ATTCCTCATG TATTGTTAAT ATTAATATCG ATGCTATCTT CAAATGAGGA
TTTATTTGAA AAAAATGTTG AGTTTGTTTC TGG

Locus: Os07g0678600

Loading...

Locus: Os07g0678600

Loading...