Os07t0680400-01

Locus

Os07g0680400

Description

WRKY transcription factor, Drought tolerance

RAP-DB Gene Symbol Synonym(s)

WRKY47, OsWRKY47

RAP-DB Gene Name Synonym(s)

WRKY GENE 47, Rice WRKY gene47

CGSNL Gene Symbol

WRKY47

CGSNL Gene Name

WRKY GENE 47

Oryzabase Gene Symbol Synonym(s)

OsWRKY47

Oryzabase Gene Name Synonym(s)

Rice WRKY gene47

Transcript Evidence

AK110900

HQ858848

Protein Evidence

Q7XHX5

Literature

PMID: 25957211

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

September 11, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain (IPR003657)

Full-length cDNA

002-173-B01 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0680400-01)

RiceXPro (AK110900)

Others

Oryzabase (6561)

KEGG (Os07t0680400-01)

Transcript

1776 bp

>Os07t0680400-01 WRKY transcription factor, Drought tolerance
TATATTGCTTATCCCTCAACGTCCTGTACCGGATGTGTGATGACTTGTATGCATGACCAG
TGAAGGAGCAAAGGGGTTCACTAGCACCAGCCGGGCCGTGCATGGAGCATGAACCGACCG
TCCATGAGCTCACGGCCTCGTCACGGCGATGACGTACAGGCGACACACATCCAGCTGGGC
CCCTCCTTCCATGTTCCAAGCCATTTCCTTTGGTGAGTTGTTCTTCCTCTTCCCCCCCTC
CCGATCGCCCTCGTCGTCTACTTTTCCTCTCAACTTCCCACCGAGCACACCAATAAAAAC
TGCAGCTGCTGCCCAATAACCTATCTACTCTAGCAGTCTAGCTACGGCTGATGAGCAGGT
GTCAATACAAGAGTAGCAAAGCTGAGAATATCTAGTTCCTACTTTGCTAGCTTTCCTAGT
AATACTAGACTGCTAGCAGCAGCAATTAGCTATAGTAGCGGCTCCTCCCATGGCGTCTCC
TGATGGTGGCGTTGGAGACGGCGGCGCGGAGCCACATGAAGTTATGGACGACCTGCTCGA
GATGCGCGAGCAAGCGGCGATGCTCCACAGCATGCTACATGGGACATCGCCGTCGAGCTG
TGCGGCGGCGGCGAGCACCAGGCAGCTGAATCAGCTGATAGACGGGGTGATGAGCAGGCT
GCAGTCCAGCTCGCTGTCGGTGATGTCGCCTGGAGGAGGAGGAGGAAGAAGAGGATCGGG
CGGGAGGAAGAAGAAAGGCGCCAAGGCCGTGGCCGGGCCGCACAGGCGGAGCAGCTCCGG
TAGAAGAAGATCGAAAAGTCCTTTTGTCAGGATGGTCACGACCAAGGAGCTGGAGGACGG
CAGGCAATGGCGAAAGTACGGGCAGAAACATATACAGGACTCCCCAAATAATCCAAGGAG
CTACTACAGGTGCACGCATAGGCCAGACCAAGGTTGTATGGCCACAAAGCAAGTACAGAC
CTCCGAGTCTAACTCGTCGGAGTTCGTCATCAGCTACTACGGTGAGCACACCTGCAGCGA
CCCTTCCACCATCCCGTTCGTCGTCGAGGCCGAAGCTCCCGCTGCAGACTACGCGAACCT
CATCAGCTTCGGATCCAGCGGCGGCGCGAGCACAAGCAGAGTCGACCCTCTTCGTCAGAG
CCGCCATCGTTTGATGGCAGAAGCCGTTGATCCGACGCCGTCCTGCAGCTTCGCCAACTG
CCACTCTCCGGTACTGTCCTCGGAGTGCGCCAGCGAGGCGGCGGCGCTCAGCAGCAGCCT
GCCGCTCTCCGCCGTGGTGGGATCGGCGGTGACAACGCCGTCGACGTCGATCGTGGGTTC
AGCGCCTGCGGATTACGACTGGCCGTCAGGGCTCGCCGGAGGTGACATGGCCGGCAGCTT
CCCGTCCTCTCCCAGCAGCCTCGGGTTCATGACTGGCTCCTTTGGGAATCTTCCTGGGGA
TGACGACGACATGTTTGGCTTCGATCCTTAACAAGGGCTGTGCATGCATACATTCTTGCC
ATGCTAATTATTGCTACTACTAATATTCAAGAAAAACAAGTCCGCTATTTGCATGCAGAA
GTGTATGCATGCATGCATAATACTATTGCTGTGAGGCTATAGCAAATTAGCAATACTTGT
AGTACATGTGTGTACTGCTATTGGAGGAAATCCAATATATATACGGTACGTAGTAAATAT
GTGTATTAGTTGATCGCTGTACTAGTGAGTTGTGTGTATGTGATTTTGTAAGTATTGAAA
CATAATTTGAAATTAATATATAGTAGTGAAAGTAAT

CDS

1002 bp

>Os07t0680400-01 WRKY transcription factor, Drought tolerance
ATGGCGTCTCCTGATGGTGGCGTTGGAGACGGCGGCGCGGAGCCACATGAAGTTATGGAC
GACCTGCTCGAGATGCGCGAGCAAGCGGCGATGCTCCACAGCATGCTACATGGGACATCG
CCGTCGAGCTGTGCGGCGGCGGCGAGCACCAGGCAGCTGAATCAGCTGATAGACGGGGTG
ATGAGCAGGCTGCAGTCCAGCTCGCTGTCGGTGATGTCGCCTGGAGGAGGAGGAGGAAGA
AGAGGATCGGGCGGGAGGAAGAAGAAAGGCGCCAAGGCCGTGGCCGGGCCGCACAGGCGG
AGCAGCTCCGGTAGAAGAAGATCGAAAAGTCCTTTTGTCAGGATGGTCACGACCAAGGAG
CTGGAGGACGGCAGGCAATGGCGAAAGTACGGGCAGAAACATATACAGGACTCCCCAAAT
AATCCAAGGAGCTACTACAGGTGCACGCATAGGCCAGACCAAGGTTGTATGGCCACAAAG
CAAGTACAGACCTCCGAGTCTAACTCGTCGGAGTTCGTCATCAGCTACTACGGTGAGCAC
ACCTGCAGCGACCCTTCCACCATCCCGTTCGTCGTCGAGGCCGAAGCTCCCGCTGCAGAC
TACGCGAACCTCATCAGCTTCGGATCCAGCGGCGGCGCGAGCACAAGCAGAGTCGACCCT
CTTCGTCAGAGCCGCCATCGTTTGATGGCAGAAGCCGTTGATCCGACGCCGTCCTGCAGC
TTCGCCAACTGCCACTCTCCGGTACTGTCCTCGGAGTGCGCCAGCGAGGCGGCGGCGCTC
AGCAGCAGCCTGCCGCTCTCCGCCGTGGTGGGATCGGCGGTGACAACGCCGTCGACGTCG
ATCGTGGGTTCAGCGCCTGCGGATTACGACTGGCCGTCAGGGCTCGCCGGAGGTGACATG
GCCGGCAGCTTCCCGTCCTCTCCCAGCAGCCTCGGGTTCATGACTGGCTCCTTTGGGAAT
CTTCCTGGGGATGACGACGACATGTTTGGCTTCGATCCTTAA

Protein

334 aa

>Os07t0680400-01 WRKY transcription factor, Drought tolerance
MASPDGGVGDGGAEPHEVMDDLLEMREQAAMLHSMLHGTSPSSCAAAASTRQLNQLIDGV
MSRLQSSSLSVMSPGGGGGRRGSGGRKKKGAKAVAGPHRRSSSGRRRSKSPFVRMVTTKE
LEDGRQWRKYGQKHIQDSPNNPRSYYRCTHRPDQGCMATKQVQTSESNSSEFVISYYGEH
TCSDPSTIPFVVEAEAPAADYANLISFGSSGGASTSRVDPLRQSRHRLMAEAVDPTPSCS
FANCHSPVLSSECASEAAALSSSLPLSAVVGSAVTTPSTSIVGSAPADYDWPSGLAGGDM
AGSFPSSPSSLGFMTGSFGNLPGDDDDMFGFDP*

5'UTR

chr07:28831838..28831910 (- strand) : 73 bp

chr07:28831027..28831422 (- strand) : 396 bp

CDS

chr07:28830707..28831026 (- strand) : 320 bp

chr07:28830164..28830271 (- strand) : 108 bp

chr07:28829103..28829676 (- strand) : 574 bp

3'UTR

chr07:28828798..28829102 (- strand) : 305 bp

FASTA

>Os07t0680400-01 class=Sequence position=chr07:28828798..28831910 (- strand)
TATATTGCTT ATCCCTCAAC GTCCTGTACC GGATGTGTGA TGACTTGTAT GCATGACCAG TGAAGGAGCA AAGGTAACAC
GTGTATATCT TCTACTTGTC CTTCAGTTAG CTTGCACTGC ATGCTAAGTG AAAACTTCTA ATATTCAAGT GCCAACATGC
CACTTAGAAA ATGTATGAGT GACAACTATA CATCAACTAA TAACAGCTGT AGTGCTAGCA TCATCACTAG GCAAGTAGTA
GTGAAAAATT GTCTGCCATC AGATCTACAA GAAGATAGGC ATCTAACGCA TGCAATGGCT TGAAATTAAA CAACTGCTGC
ACTTGCAATA TAACTATGCA TTCCATATAC CATATATAAA TGAAAAGAAC CAAGCATGAA TTTCTCCACC ACAGTTGGGA
GCTAGCTAGG ACCATTCCAC ATTTTCCCAG TGATTAAACA ATCATCTTAA TTATATACGA TTTCCAGTAC TGCCATTTTT
TTTCTCAGGG GTTCACTAGC ACCAGCCGGG CCGTGCATGG AGCATGAACC GACCGTCCAT GAGCTCACGG CCTCGTCACG
GCGATGACGT ACAGGCGACA CACATCCAGC TGGGCCCCTC CTTCCATGTT CCAAGCCATT TCCTTTGGTG AGTTGTTCTT
CCTCTTCCCC CCCTCCCGAT CGCCCTCGTC GTCTACTTTT CCTCTCAACT TCCCACCGAG CACACCAATA AAAACTGCAG
CTGCTGCCCA ATAACCTATC TACTCTAGCA GTCTAGCTAC GGCTGATGAG CAGGTGTCAA TACAAGAGTA GCAAAGCTGA
GAATATCTAG TTCCTACTTT GCTAGCTTTC CTAGTAATAC TAGACTGCTA GCAGCAGCAA TTAGCTATAG TAGCGGCTCC
TCCCATGGCG TCTCCTGATG GTGGCGTTGG AGACGGCGGC GCGGAGCCAC ATGAAGTTAT GGACGACCTG CTCGAGATGC
GCGAGCAAGC GGCGATGCTC CACAGCATGC TACATGGGAC ATCGCCGTCG AGCTGTGCGG CGGCGGCGAG CACCAGGCAG
CTGAATCAGC TGATAGACGG GGTGATGAGC AGGCTGCAGT CCAGCTCGCT GTCGGTGATG TCGCCTGGAG GAGGAGGAGG
AAGAAGAGGA TCGGGCGGGA GGAAGAAGAA AGGCGCCAAG GCCGTGGCCG GGCCGCACAG GCGGAGCAGC TCCGGTAGAA
GAAGGTGAAG AAAGTTAAAA CCCTTTTTTC TCAATAATCA TCTGCAACTG GATGCGCAAC TAGCTAGCTA TGCTTACCAC
ATGCGGTAGT AATACTATTA CCCATATATA TGATAGCGAT TCACACATCA TGCTAGCTAC CTCCTTTATG CAACTTGGAG
AGTACGTTGG GAGTATATTG CCTTGTCTAG CAGTGGGGTT TAATCTTAAC TTTACGTGCC AATGATCAGG GGGGAATTTT
TACTACCAGT AGCTTTCTTC TCTCACAAAA GATCATTTCC TGTTTCTTAT ATTGAAAAGA CCAAAAGCTA TGAGCAACTA
GCTATATATA TGACACTCTT GTATACGTAC ATACCGTGGT CTGCCGAGCA TGCTAGTGGA GATTTGGGTG TGTGTCTCTG
GATATGATAG TTGCTCCTAT CTGCTGTAAC ATGTGGCAGA TCGAAAAGTC CTTTTGTCAG GATGGTCACG ACCAAGGAGC
TGGAGGACGG CAGGCAATGG CGAAAGTACG GGCAGAAACA TATACAGGAC TCCCCAAATA ATCCAAGGTA TGTACGTATA
GATTATTCAA CTAATTCTGC AGTAACATGA CCAGATTCTT CGCCCTTGTG CATGGTAGTT AGCTAGTACG TAATGATGAT
TAACCCAGCA AGAAATTAAA GGCCCTTGTA CCGGCCGATC GAACACTTGC CAATGCAACT GGACAACTCG CTTAGCTACT
CCAGTTAATT GGAGAATAGT GTTCCGATCT TCCGGTTCCG GCCGGATCAT GGTTAGCTTC ACATAGTTAG ATATATACTA
CTCCAATACA CATGTGCTTA ATTCAATTGA ACTGTATTAG TTAGTTGTTG CAATTACTAA AAAGAGTAGG AAAATACTGC
TCAACTTGAA CTGTGTATTT ATTATTAGAT AGCAACATAG CATAGTTAGC ACCAAATCGT TGCTGTAACA TGTTATCTAT
TCAGGAGCAT CATACGATGC AATTTTGCAG CTTGCATTCC TTAATTAAAG ATCTAGTTGT TGATCTCTCT GCAGGAGCTA
CTACAGGTGC ACGCATAGGC CAGACCAAGG TTGTATGGCC ACAAAGCAAG TACAGACCTC CGAGTCTAAC TCGTCGGAGT
TCGTCATCAG CTACTACGGT GAGCACACCT GCAGCGACCC TTCCACCATC CCGTTCGTCG TCGAGGCCGA AGCTCCCGCT
GCAGACTACG CGAACCTCAT CAGCTTCGGA TCCAGCGGCG GCGCGAGCAC AAGCAGAGTC GACCCTCTTC GTCAGAGCCG
CCATCGTTTG ATGGCAGAAG CCGTTGATCC GACGCCGTCC TGCAGCTTCG CCAACTGCCA CTCTCCGGTA CTGTCCTCGG
AGTGCGCCAG CGAGGCGGCG GCGCTCAGCA GCAGCCTGCC GCTCTCCGCC GTGGTGGGAT CGGCGGTGAC AACGCCGTCG
ACGTCGATCG TGGGTTCAGC GCCTGCGGAT TACGACTGGC CGTCAGGGCT CGCCGGAGGT GACATGGCCG GCAGCTTCCC
GTCCTCTCCC AGCAGCCTCG GGTTCATGAC TGGCTCCTTT GGGAATCTTC CTGGGGATGA CGACGACATG TTTGGCTTCG
ATCCTTAACA AGGGCTGTGC ATGCATACAT TCTTGCCATG CTAATTATTG CTACTACTAA TATTCAAGAA AAACAAGTCC
GCTATTTGCA TGCAGAAGTG TATGCATGCA TGCATAATAC TATTGCTGTG AGGCTATAGC AAATTAGCAA TACTTGTAGT
ACATGTGTGT ACTGCTATTG GAGGAAATCC AATATATATA CGGTACGTAG TAAATATGTG TATTAGTTGA TCGCTGTACT
AGTGAGTTGT GTGTATGTGA TTTTGTAAGT ATTGAAACAT AATTTGAAAT TAATATATAG TAGTGAAAGT AAT

Locus: Os07g0680400

Loading...

Locus: Os07g0680400

Loading...