Os07t0681300-00

Locus

Os07g0681300

Description

Cytochrome P450 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP714B1

CGSNL Gene Name

P-450 714B1

Oryzabase Gene Symbol Synonym(s)

OsCYP714B1

Oryzabase Gene Name Synonym(s)

Cytochrome P450 714B1

Transcript Evidence

AK252161 (DDBJ)

Protein Evidence

B6SSW8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Expression Databases

TENOR (Os07t0681300-00)

Others

Oryzabase (12263)

KEGG (Os07t0681300-00)

Transcript

1621 bp

>Os07t0681300-00 Cytochrome P450 family protein.
AGATCGAGATATCGACATGGTGGTGGTGGTGGCGGCGGCCATGGCGGCGGCGAGCTTGTG
CTGCGGCGTGGCGGCGTACCTCTACTACGTCCTGTGGCTGGCGCCGGAGAGGCTCCGCGC
CCACCTGAGAAGACAAGGGATCGGCGGCCCAACCCCGTCCTTCCCTTACGGCAACCTCGC
CGACATGAGGAGCCACGCCGCCGCCGCCGCCGGCGGCAAGGCTACCGGAGAAGGACGACA
AGAAGGCGACATCGTGCACGACTACCGGCAGGCCGTCTTCCCCTTCTACGAGAATTGGAG
AAAACAATACGGCCCGGTATTCACGTATTCAGTAGGGAACATGGTGTTCCTGCACGTGAG
CCGGCCGGACATAGTCCGGGAGCTGAGCCTGTGCGTGTCGCTGGACCTCGGCAAGAGCTC
GTACATGAAGGCCACGCACCAGCCTCTCTTCGGCGAGGGCATCCTCAAGTCCAACGGCAA
CGCCTGGGCTCACCAGAGAAAGCTCATTGCCCCCGAGTTCTTCCCCGACAAGGTCAAGGG
TATGGTCGATCTGATGGTGGACTCGGCACAGGTCCTAGTCAGTTCATGGGAAGACAGGAT
TGACAGAAGTGGCGGGAATGCACTGGACCTGATGATTGACGATGACATCAGGGCATACTC
TGCTGATGTGATCTCCAGGACATGCTTCGGTAGCAGCTACGTGAAAGGCAAGCAGATCTT
CGACATGATCAGGGAGCTGCAGAAGACGGTGTCCACCAAGAAGCAGAACCTGCTCGCCGA
GATGACCGGGCTCAGCTTCCTCTTCCCGAAGGCGAGCGGCCGCGCGGCGTGGCGGCTCAA
CGGGCGTGTCCGCGCCCTGATACTCGACCTCGTCGGAGAGAACGGGGAGGAGGACGGTGG
CAACCTCCTCAGCGCGATGCTCCGGAGCGCCAGAGGCGGCGGCGGTGGCGGCGGCGAGGT
CGCCGCCGCGGCCGAGGACTTCGTTGTGGACAACTGCAAGAACATCTACTTCGCCGGGTA
CGAGAGCACGGCGGTCACCGCCGCGTGGTGCTTGATGCTGCTCGCGCTTCACCCTGAGTG
GCAGGACCGGGTGCGAGACGAGGTGCAGGCGGCGTGCTGCGGCGGCGGCGGACGGTCGCC
GGACTTCCCGGCACTGCAGAAGATGAAGAACCTGACGATGGTGATCCAGGAGACGCTGCG
GCTGTACCCGGCGGGCGCGGTGGTGTCGCGGCAGGCGCTGCGGGAGCTCAGCCTCGGCGG
CGTGCGCGTGCCGAGGGGCGTCAACATCTACGTCCCGGTCTCGACGCTGCACCTGGACGC
GGAGCTGTGGGGGGGCGGCGCCGGCGCGGCGGAGTTCGACCCGGCGCGGTTCGCCGACGC
CCGGCCGCCGCTGCACGCGTACCTGCCGTTCGGCGCCGGCGCGCGCACCTGCCTCGGCCA
GACCTTCGCCATGGCAGAGCTCAAGGTGCTCCTCTCGCTCGTGCTCTGCAGGTTCGAGGT
GGCGCTGTCGCCGGAGTACGTGCACTCGCCGGCGCACAAGCTCATCGTGGAGGCCGAGCA
CGGCGTGCGCCTTGTGCTCAAGAAAGTGCGGTCCAAGTGTGATTGGGCTGGATTTGATTA
G

CDS

1605 bp

>Os07t0681300-00 Cytochrome P450 family protein.
ATGGTGGTGGTGGTGGCGGCGGCCATGGCGGCGGCGAGCTTGTGCTGCGGCGTGGCGGCG
TACCTCTACTACGTCCTGTGGCTGGCGCCGGAGAGGCTCCGCGCCCACCTGAGAAGACAA
GGGATCGGCGGCCCAACCCCGTCCTTCCCTTACGGCAACCTCGCCGACATGAGGAGCCAC
GCCGCCGCCGCCGCCGGCGGCAAGGCTACCGGAGAAGGACGACAAGAAGGCGACATCGTG
CACGACTACCGGCAGGCCGTCTTCCCCTTCTACGAGAATTGGAGAAAACAATACGGCCCG
GTATTCACGTATTCAGTAGGGAACATGGTGTTCCTGCACGTGAGCCGGCCGGACATAGTC
CGGGAGCTGAGCCTGTGCGTGTCGCTGGACCTCGGCAAGAGCTCGTACATGAAGGCCACG
CACCAGCCTCTCTTCGGCGAGGGCATCCTCAAGTCCAACGGCAACGCCTGGGCTCACCAG
AGAAAGCTCATTGCCCCCGAGTTCTTCCCCGACAAGGTCAAGGGTATGGTCGATCTGATG
GTGGACTCGGCACAGGTCCTAGTCAGTTCATGGGAAGACAGGATTGACAGAAGTGGCGGG
AATGCACTGGACCTGATGATTGACGATGACATCAGGGCATACTCTGCTGATGTGATCTCC
AGGACATGCTTCGGTAGCAGCTACGTGAAAGGCAAGCAGATCTTCGACATGATCAGGGAG
CTGCAGAAGACGGTGTCCACCAAGAAGCAGAACCTGCTCGCCGAGATGACCGGGCTCAGC
TTCCTCTTCCCGAAGGCGAGCGGCCGCGCGGCGTGGCGGCTCAACGGGCGTGTCCGCGCC
CTGATACTCGACCTCGTCGGAGAGAACGGGGAGGAGGACGGTGGCAACCTCCTCAGCGCG
ATGCTCCGGAGCGCCAGAGGCGGCGGCGGTGGCGGCGGCGAGGTCGCCGCCGCGGCCGAG
GACTTCGTTGTGGACAACTGCAAGAACATCTACTTCGCCGGGTACGAGAGCACGGCGGTC
ACCGCCGCGTGGTGCTTGATGCTGCTCGCGCTTCACCCTGAGTGGCAGGACCGGGTGCGA
GACGAGGTGCAGGCGGCGTGCTGCGGCGGCGGCGGACGGTCGCCGGACTTCCCGGCACTG
CAGAAGATGAAGAACCTGACGATGGTGATCCAGGAGACGCTGCGGCTGTACCCGGCGGGC
GCGGTGGTGTCGCGGCAGGCGCTGCGGGAGCTCAGCCTCGGCGGCGTGCGCGTGCCGAGG
GGCGTCAACATCTACGTCCCGGTCTCGACGCTGCACCTGGACGCGGAGCTGTGGGGGGGC
GGCGCCGGCGCGGCGGAGTTCGACCCGGCGCGGTTCGCCGACGCCCGGCCGCCGCTGCAC
GCGTACCTGCCGTTCGGCGCCGGCGCGCGCACCTGCCTCGGCCAGACCTTCGCCATGGCA
GAGCTCAAGGTGCTCCTCTCGCTCGTGCTCTGCAGGTTCGAGGTGGCGCTGTCGCCGGAG
TACGTGCACTCGCCGGCGCACAAGCTCATCGTGGAGGCCGAGCACGGCGTGCGCCTTGTG
CTCAAGAAAGTGCGGTCCAAGTGTGATTGGGCTGGATTTGATTAG

Protein

535 aa

>Os07t0681300-00 Cytochrome P450 family protein.
MVVVVAAAMAAASLCCGVAAYLYYVLWLAPERLRAHLRRQGIGGPTPSFPYGNLADMRSH
AAAAAGGKATGEGRQEGDIVHDYRQAVFPFYENWRKQYGPVFTYSVGNMVFLHVSRPDIV
RELSLCVSLDLGKSSYMKATHQPLFGEGILKSNGNAWAHQRKLIAPEFFPDKVKGMVDLM
VDSAQVLVSSWEDRIDRSGGNALDLMIDDDIRAYSADVISRTCFGSSYVKGKQIFDMIRE
LQKTVSTKKQNLLAEMTGLSFLFPKASGRAAWRLNGRVRALILDLVGENGEEDGGNLLSA
MLRSARGGGGGGGEVAAAAEDFVVDNCKNIYFAGYESTAVTAAWCLMLLALHPEWQDRVR
DEVQAACCGGGGRSPDFPALQKMKNLTMVIQETLRLYPAGAVVSRQALRELSLGGVRVPR
GVNIYVPVSTLHLDAELWGGGAGAAEFDPARFADARPPLHAYLPFGAGARTCLGQTFAMA
ELKVLLSLVLCRFEVALSPEYVHSPAHKLIVEAEHGVRLVLKKVRSKCDWAGFD*

5'UTR

chr07:28882173..28882188 (+ strand) : 16 bp

CDS

chr07:28882189..28882483 (+ strand) : 295 bp

chr07:28884800..28885026 (+ strand) : 227 bp

chr07:28885179..28885811 (+ strand) : 633 bp

chr07:28885889..28886338 (+ strand) : 450 bp

FASTA

>Os07t0681300-00 class=Sequence position=chr07:28882173..28886338 (+ strand)
AGATCGAGAT ATCGACATGG TGGTGGTGGT GGCGGCGGCC ATGGCGGCGG CGAGCTTGTG CTGCGGCGTG GCGGCGTACC
TCTACTACGT CCTGTGGCTG GCGCCGGAGA GGCTCCGCGC CCACCTGAGA AGACAAGGGA TCGGCGGCCC AACCCCGTCC
TTCCCTTACG GCAACCTCGC CGACATGAGG AGCCACGCCG CCGCCGCCGC CGGCGGCAAG GCTACCGGAG AAGGACGACA
AGAAGGCGAC ATCGTGCACG ACTACCGGCA GGCCGTCTTC CCCTTCTACG AGAATTGGAG AAAACAATAC GGTACGCACG
TGTATATCGA TCAACGATCA TATATCCCTG CTAGCTGCTG TTTGATTGGT TGCATGCTAC TACTGCTCTG CCCATGCTGT
GTGATCTTCG TCTTCCTGCC TCTACATAAA ACAGAACTCA CCCTGATTTA GAACAAGAAA AGAATAATAA CAGAATTGCT
AGGTTTCTTG CGACATTTTT TTTTTTGAAA GAAAACTTTT GATTTTTGGA CCGTTAGAAC TGCTATAAGA TTCATGTAGG
AAAGTTATAA TGTGATTGTA CCTTTGCTAT ATTTGATTTT TTTTAAAAAA AAATTGCGCC AGATTTTTAA GATAGttttt
ttaggggaaa aggagatata ttactcatat atggcgtcaa cacgcgctaa atgcatgatg aaattacaac tgtttcctag
ccaaacattt gacaaggatt cacatctagc tttatttgct aacaaatgac tgatcccatt ttggctgcca tggatcttca
ttagcttaat ctccctGCTC CCAGAAAGGA GATAGTTAGG TCATGTGTGT GTAAGGAAGA AGAATCTGCC CGGTGGTAAA
GGAGTAATCA ACGGCTGTAA TCAATCGATT TAATTACTAA TAATCATTAG TATTAATCAT TTCCAACTTT CGGTAATGAA
TGGATTTAAA TATATATAGT GAAGATTTGG TTCTTTCTAC AAAGTAAATA GTGGAGTACT ACTACTATAT ATGAAAAGTT
TCAGAGTACG TATACTATAC GTCCGTTCAT TAATAGAGCA ACAAAAGCAT ATGCATGCTG ATAGGAAAGT TTATCTATCC
CTCGTTTTTG CATGCTGact gtaaatactg catatatgta aagtcaaatt tattttttaa tctatgcaag tagaatttaa
acatgcattt aagtataacg atactactat atctatatta ttaaatattt tcttatgact tactaagtga tatgcaccaa
acaaggagCC GTCTCCTTTA GGGTAGTtgt cgatttcgag cattcatatc aattgaaaaa gttattacaa aaattaaaaa
aaaacaagtc actcataaag tgttattcat gttttatcat ctaataacaa caaaaatatt aatcataaaa agaattaaat
aaaacggacg gtcaaacgtt gaaaaaaaac ccacaactat atttagaatg agacagagga agtAATTGAT ACCAGTAGTG
CAATATAGGG CATGtttaga tcccctagca aaattttaca tcctatcaca tcgaatgttt gtacaaatgc attgagtatt
aaatataaac gaaaaaataa ctaattgcac agattacgta taaattgcga gacgaatctt taaagcctaa ttgcgccatg
atttgacaac gtggtgctac aatatacatt tgctaatgac ggattaatta ggcttaacaa attcgtctcg cggtttacag
acggattata tcatttattt tgttattaga ctacgtttaa tactttaaat gcatccatat atccgatgtg acatatcaaa
actttatccc atatatctaa acacagccAT AGCATTATTG AGCCGTCAGA ATCATGGGCA GTCTCTGTGG TGTTTTGTAC
TGTGTCTGGG TTTGCTTCAT TTAATTGCAC CGAGTTCCAT CGACGAGCTA GCGATAGAGA GATTTGCCAT GGTATGTCAT
TACCACGGGA AAGTTGTGTC CTTTTCAGGA ATCGTAGCTT GCCAGCGTTG CACGCACAGC CAGCCACTGT ACGACTGTCT
AGATAGCCGG CCGATTGCAC GACGTGATCG ATCGAAATAT ATTTTCCTCG TCGATTGATA GCGAAGTTCA TGTAACTAGC
AAACAGCAGC ACGATCTCAG CTCACATGAA CCAGCAAATT ATAAACATGC CCCCAGTTTG GAGCAAATTA AACGGCTCCA
GGCATACGTG CGGTGTACTC CTGTTCATAA ATGACCTGCG CGCACTGCAG CTAGCTAGTG CAGGTGTGTG ACTCTTTGAT
GTGGATTTGA TCCGTCCTCC CGATCCGCTA GCGTCAATGG AGGAGCTACC CAGCTTTCAT GTCAGCTAGT GTAGTTTTGT
CATGTTGTGA ACATTCGTCC AAGTAGACTA ATGGTATATt actaccttca tttcatatta caaatcgctt taattttttt
ctagtctaat ttctttttaG TTCTTTCAGT AAAGGGAACG AAGAATATAG CGTGTACTTT CAATTTCCAA GCACATGTTT
AGATAAAAGG GATAGTTTGA AAGCTTTGTA ACCGACTGGT GCATCTTAAT TTTGCTCTTG GTGTTAGGCC CGGTATTCAC
GTATTCAGTA GGGAACATGG TGTTCCTGCA CGTGAGCCGG CCGGACATAG TCCGGGAGCT GAGCCTGTGC GTGTCGCTGG
ACCTCGGCAA GAGCTCGTAC ATGAAGGCCA CGCACCAGCC TCTCTTCGGC GAGGGCATCC TCAAGTCCAA CGGCAACGCC
TGGGCTCACC AGAGAAAGCT CATTGCCCCC GAGTTCTTCC CCGACAAGGT CAAGGTCGGT GTATCTTCTC AAGGATAGTA
AAATCACTGG CTCGTTAATT AATCTTCCAA ACAACATCTG CAAGCTTAGT TTGCAAATGA TCGATCGATC TGATGTATTT
TCACTAACAA ATTAGTGTCT CTTAATATGC AAATGTGATC ATGTAGGGTA TGGTCGATCT GATGGTGGAC TCGGCACAGG
TCCTAGTCAG TTCATGGGAA GACAGGATTG ACAGAAGTGG CGGGAATGCA CTGGACCTGA TGATTGACGA TGACATCAGG
GCATACTCTG CTGATGTGAT CTCCAGGACA TGCTTCGGTA GCAGCTACGT GAAAGGCAAG CAGATCTTCG ACATGATCAG
GGAGCTGCAG AAGACGGTGT CCACCAAGAA GCAGAACCTG CTCGCCGAGA TGACCGGGCT CAGCTTCCTC TTCCCGAAGG
CGAGCGGCCG CGCGGCGTGG CGGCTCAACG GGCGTGTCCG CGCCCTGATA CTCGACCTCG TCGGAGAGAA CGGGGAGGAG
GACGGTGGCA ACCTCCTCAG CGCGATGCTC CGGAGCGCCA GAGGCGGCGG CGGTGGCGGC GGCGAGGTCG CCGCCGCGGC
CGAGGACTTC GTTGTGGACA ACTGCAAGAA CATCTACTTC GCCGGGTACG AGAGCACGGC GGTCACCGCC GCGTGGTGCT
TGATGCTGCT CGCGCTTCAC CCTGAGTGGC AGGACCGGGT GCGAGACGAG GTGCAGGCGG CGTGCTGCGG CGGCGGCGGA
CGGTCGCCGG ACTTCCCGGC ACTGCAGAAG ATGAAGAACG TACGCCGCCG ACACGCATCA AATTGTTGGC ATTGAAGCTC
GCCGAAGCTG ATATGATCGT GCTGTTTAAT TTGCAGCTGA CGATGGTGAT CCAGGAGACG CTGCGGCTGT ACCCGGCGGG
CGCGGTGGTG TCGCGGCAGG CGCTGCGGGA GCTCAGCCTC GGCGGCGTGC GCGTGCCGAG GGGCGTCAAC ATCTACGTCC
CGGTCTCGAC GCTGCACCTG GACGCGGAGC TGTGGGGGGG CGGCGCCGGC GCGGCGGAGT TCGACCCGGC GCGGTTCGCC
GACGCCCGGC CGCCGCTGCA CGCGTACCTG CCGTTCGGCG CCGGCGCGCG CACCTGCCTC GGCCAGACCT TCGCCATGGC
AGAGCTCAAG GTGCTCCTCT CGCTCGTGCT CTGCAGGTTC GAGGTGGCGC TGTCGCCGGA GTACGTGCAC TCGCCGGCGC
ACAAGCTCAT CGTGGAGGCC GAGCACGGCG TGCGCCTTGT GCTCAAGAAA GTGCGGTCCA AGTGTGATTG GGCTGGATTT
GATTAG

Locus: Os07g0681300

Loading...

Locus: Os07g0681300

Loading...