Os07t0684800-01

Locus

Os07g0684800

Description

Similar to NAM / CUC2-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC15

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 15

Oryzabase Gene Symbol Synonym(s)

ONAC015, ONAC15, ONAC069, ONAC69

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 015, NAC domain-containing protein 15, NAC domain-containing protein 69

Transcript Evidence

AK073876 (DDBJ, Best hit)

Protein Evidence

A2YQ18 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J033072L16 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0684800-01)

RiceXPro (AK073876)

Others

Oryzabase (11465)

KEGG (Os07t0684800-01)

Transcript

1643 bp

>Os07t0684800-01 Similar to NAM / CUC2-like protein.
CTTCCTAAACCCATCTCGATCCCTACCTAGCTAAGCTATTTCATTCACACCTCGATCAAT
CTCGATCGTCTCTCTCGTCTACTACTAGTACTAGCTTCTTCTCCTCCATTTCTGACCTGA
GCTAGCTCAGAACAGAGAGCTGAGAATCATCAGCTAGCTAGCTAGGCGTCTGGGGAGAGA
GCAGGAGCCATGTCGGAGTCGGAGGTGTCGGTGATCAACCAGCTGGAGGAGGAGGAGACT
CGGCTGGAGCTGCCGCCGGGGTTCCGGTTCCACCCCACCGACGAGGAGGTGGTGACCCAC
TACCTCACCCGCAAGGCCCAGGACCGGAGCTTCTCCTGCGTCGTCATCGCCGACGTGAAC
CTCAACAACTGCGAGCCATGGGACCTCCCAAgcaaggcgaagatgggggagaaggagtgg
ttcttcttctgccacaaggaccgcaagtacccgacggggatgaggacgaaccgggcgacg
gccagcgggtactggaaggccaccgggaaggacaaggagatcttccgcggccgcggcctc
ctcgtcggcatgaagaagacgctcgtcttctacatgggccgcgccccccgcggcgagaag
accccctgggtcatgcacgaataccgcctCGACGGCAAGCTTCCCCCCAACCTCCCCCGC
TCCGCAAAGGAGGAATGGGCGGTTTGCCGGGTGTTCAACAAAGACTTGGCGGCAAAGATT
GCCCAAATGCCGCCGCCTCCCTTCCCGCGCAACGACTCCTTCGACCTCGACCTCGACGAC
TTCCTCCACCTCGACGCCGACCTGCCGCCGCTCATCGACGACCCCTTCGCCTCCACCTCC
ACGCTCAAGACGGAGCCACCTCCGCCGGCCAACCTGATGCACAACCACTACGGCTACTTC
TCCCTCCCGGCGTCAGCGACCAATTATAACCACAGCTCCGGCGCCATGGCGGACCAGGCG
ATTCGGAGGTTCTGCAAGGCGGAGGCGTCGACGGCGTGCTTCTCCGGCGCCGACGCTGAC
GTGGATCCGGTGGTGGACGAGCTGCTCTCCTTCCCGGACTCCATCACGGACTACTCCTAC
ATATGGAAGGCCTGACCAGATTAATTTCGTGGTTAATTTGCCATATGATCGATCAGATTA
ATCCTGTTTAATTAGTTGGTTTATTAACTTGATTACTGTCAAAGGTTTGGGTTAACTAGG
AGATGATGATGATGGAGTTTGTGGTGATGCGAGAGAGAGAGAGATTAGGTCGCGCTGATC
TGGTCTGATCAAGGTGTGCAGAGCAGATGGAGCGGACTAATTCATTAATTAGCTTAATCA
AATTAGTTATATAGGTTTGTTTGTCTTAATTCTGTATGTATATAGTTATCTGATTGGGGA
TAATACATAGAGATTACTAGCTAGCTAGCTAGTTTGGTGATTAGGGGGGTGATGAGCTAG
CTAGAGAGAGATATCTCATCAAAATTAAGGTCTCGGTTGGTTGATTAATCTGCAGATTAT
ATATTGCCTTGTGTGTGATAGGCCATGTGGCCTCTTTCTGTGTATGTGTGTGTGTGGATG
GAAGGAGTAAATTAACTAAACCCCTTGTACATGTACCATCAGTTGTGCTTTACTTACATG
ATCAATTCAACCATTGATCGATT

CDS

906 bp

>Os07t0684800-01 Similar to NAM / CUC2-like protein.
ATGTCGGAGTCGGAGGTGTCGGTGATCAACCAGCTGGAGGAGGAGGAGACTCGGCTGGAG
CTGCCGCCGGGGTTCCGGTTCCACCCCACCGACGAGGAGGTGGTGACCCACTACCTCACC
CGCAAGGCCCAGGACCGGAGCTTCTCCTGCGTCGTCATCGCCGACGTGAACCTCAACAAC
TGCGAGCCATGGGACCTCCCAAgcaaggcgaagatgggggagaaggagtggttcttcttc
tgccacaaggaccgcaagtacccgacggggatgaggacgaaccgggcgacggccagcggg
tactggaaggccaccgggaaggacaaggagatcttccgcggccgcggcctcctcgtcggc
atgaagaagacgctcgtcttctacatgggccgcgccccccgcggcgagaagaccccctgg
gtcatgcacgaataccgcctCGACGGCAAGCTTCCCCCCAACCTCCCCCGCTCCGCAAAG
GAGGAATGGGCGGTTTGCCGGGTGTTCAACAAAGACTTGGCGGCAAAGATTGCCCAAATG
CCGCCGCCTCCCTTCCCGCGCAACGACTCCTTCGACCTCGACCTCGACGACTTCCTCCAC
CTCGACGCCGACCTGCCGCCGCTCATCGACGACCCCTTCGCCTCCACCTCCACGCTCAAG
ACGGAGCCACCTCCGCCGGCCAACCTGATGCACAACCACTACGGCTACTTCTCCCTCCCG
GCGTCAGCGACCAATTATAACCACAGCTCCGGCGCCATGGCGGACCAGGCGATTCGGAGG
TTCTGCAAGGCGGAGGCGTCGACGGCGTGCTTCTCCGGCGCCGACGCTGACGTGGATCCG
GTGGTGGACGAGCTGCTCTCCTTCCCGGACTCCATCACGGACTACTCCTACATATGGAAG
GCCTGA

Protein

302 aa

>Os07t0684800-01 Similar to NAM / CUC2-like protein.
MSESEVSVINQLEEEETRLELPPGFRFHPTDEEVVTHYLTRKAQDRSFSCVVIADVNLNN
CEPWDLPSKAKMGEKEWFFFCHKDRKYPTGMRTNRATASGYWKATGKDKEIFRGRGLLVG
MKKTLVFYMGRAPRGEKTPWVMHEYRLDGKLPPNLPRSAKEEWAVCRVFNKDLAAKIAQM
PPPPFPRNDSFDLDLDDFLHLDADLPPLIDDPFASTSTLKTEPPPPANLMHNHYGYFSLP
ASATNYNHSSGAMADQAIRRFCKAEASTACFSGADADVDPVVDELLSFPDSITDYSYIWK
A*

5'UTR

chr07:29042109..29042297 (- strand) : 189 bp

CDS

chr07:29041907..29042108 (- strand) : 202 bp

chr07:29041532..29041809 (- strand) : 278 bp

chr07:29041004..29041429 (- strand) : 426 bp

3'UTR

chr07:29040456..29041003 (- strand) : 548 bp

FASTA

>Os07t0684800-01 class=Sequence position=chr07:29040456..29042297 (- strand)
CTTCCTAAAC CCATCTCGAT CCCTACCTAG CTAAGCTATT TCATTCACAC CTCGATCAAT CTCGATCGTC TCTCTCGTCT
ACTACTAGTA CTAGCTTCTT CTCCTCCATT TCTGACCTGA GCTAGCTCAG AACAGAGAGC TGAGAATCAT CAGCTAGCTA
GCTAGGCGTC TGGGGAGAGA GCAGGAGCCA TGTCGGAGTC GGAGGTGTCG GTGATCAACC AGCTGGAGGA GGAGGAGACT
CGGCTGGAGC TGCCGCCGGG GTTCCGGTTC CACCCCACCG ACGAGGAGGT GGTGACCCAC TACCTCACCC GCAAGGCCCA
GGACCGGAGC TTCTCCTGCG TCGTCATCGC CGACGTGAAC CTCAACAACT GCGAGCCATG GGACCTCCCA AGTAAGTAGT
AGTCTCTCGT TCATGGCGGC CTAGCTTCCT CATCGTCTGC TAGCTATTCG ATCCGATTCG ACGATGGAGC TGCatgcatg
tattgcaggc aaggcgaaga tgggggagaa ggagtggttc ttcttctgcc acaaggaccg caagtacccg acggggatga
ggacgaaccg ggcgacggcc agcgggtact ggaaggccac cgggaaggac aaggagatct tccgcggccg cggcctcctc
gtcggcatga agaagacgct cgtcttctac atgggccgcg ccccccgcgg cgagaagacc ccctgggtca tgcacgaata
ccgcctCGAC GGCAAGCTTC CCCCCAACCT CCCCCGCTCC GCAAAGGTAT TCTCTACTCG CCGCCGGCCA TGGCGATGGC
TAGCTCACAT GTCGCGTCGT TCCTCTTTCT CTTTTATTGA ATACTAGTAT ATGGTTGCGT GCGCGCAGGA GGAATGGGCG
GTTTGCCGGG TGTTCAACAA AGACTTGGCG GCAAAGATTG CCCAAATGCC GCCGCCTCCC TTCCCGCGCA ACGACTCCTT
CGACCTCGAC CTCGACGACT TCCTCCACCT CGACGCCGAC CTGCCGCCGC TCATCGACGA CCCCTTCGCC TCCACCTCCA
CGCTCAAGAC GGAGCCACCT CCGCCGGCCA ACCTGATGCA CAACCACTAC GGCTACTTCT CCCTCCCGGC GTCAGCGACC
AATTATAACC ACAGCTCCGG CGCCATGGCG GACCAGGCGA TTCGGAGGTT CTGCAAGGCG GAGGCGTCGA CGGCGTGCTT
CTCCGGCGCC GACGCTGACG TGGATCCGGT GGTGGACGAG CTGCTCTCCT TCCCGGACTC CATCACGGAC TACTCCTACA
TATGGAAGGC CTGACCAGAT TAATTTCGTG GTTAATTTGC CATATGATCG ATCAGATTAA TCCTGTTTAA TTAGTTGGTT
TATTAACTTG ATTACTGTCA AAGGTTTGGG TTAACTAGGA GATGATGATG ATGGAGTTTG TGGTGATGCG AGAGAGAGAG
AGATTAGGTC GCGCTGATCT GGTCTGATCA AGGTGTGCAG AGCAGATGGA GCGGACTAAT TCATTAATTA GCTTAATCAA
ATTAGTTATA TAGGTTTGTT TGTCTTAATT CTGTATGTAT ATAGTTATCT GATTGGGGAT AATACATAGA GATTACTAGC
TAGCTAGCTA GTTTGGTGAT TAGGGGGGTG ATGAGCTAGC TAGAGAGAGA TATCTCATCA AAATTAAGGT CTCGGTTGGT
TGATTAATCT GCAGATTATA TATTGCCTTG TGTGTGATAG GCCATGTGGC CTCTTTCTGT GTATGTGTGT GTGTGGATGG
AAGGAGTAAA TTAACTAAAC CCCTTGTACA TGTACCATCA GTTGTGCTTT ACTTACATGA TCAATTCAAC CATTGATCGA
TT

Locus: Os07g0684800

Loading...

Locus: Os07g0684800

Loading...