Os07t0684800-02

Locus

Os07g0684800

Description

Similar to NAM / CUC2-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC15

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 15

Oryzabase Gene Symbol Synonym(s)

ONAC015, ONAC15, ONAC069, ONAC69

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 015, NAC domain-containing protein 15, NAC domain-containing protein 69

Transcript Evidence

AK105645 (DDBJ, Best hit)

Protein Evidence

F1DJV8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

001-200-F06 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0684800-02)

Others

Oryzabase (11465)

Transcript

1477 bp

>Os07t0684800-02 Similar to NAM / CUC2-like protein.
TGGGGAGAGAGCAGGAGCCATGTCGGAGTCGGAGGTGTCGGTGATCAACCAGCTGGAGGA
GGAGGAGACTCGGCTGGAGCTGCCGCCGGGGTTCCGGTTCCACCCCACCGACGAGGAGGT
GGTGACCCACTACCTCACCCGCAAGGCCCAGGACCGGAGCTTCTCCTGCGTCGTCATCGC
CGACGTGAACCTCAACAACTGCGAGCCATGGGACCTCCCAAgcaaggcgaagatggggga
gaaggagtggttcttcttctgccacaaggaccgcaagtacccgacggggatgaggacgaa
ccgggcgacggccagcgggtactggaaggccaccgggaaggacaaggagatcttccgcgg
ccgcggcctcctcgtcggcatgaagaagacgctcgtcttctacatgggccgcgccccccg
cggcgagaagaccccctgggtcatgcacgaataccgcctCGACGGCAAGCTTCCCCCCAA
CCTCCCCCGCTCCGCAAAGGAGGAATGGGCGGTTTGCCGGGTGTTCAACAAAGACTTGGC
GGCAAAGATTGCCCAAATGCCGCCGCCTCCCTTCCCGCGCAACGACTCCTTCGACCTCGA
CCTCGACGACTTCCTCCACCTCGACGCCGACCTGCCGCCGCTCATCGACGACCCCTTCGC
CTCCACCTCCACGCTCAAGACGGAGCCACCTCCGCCGGCCAACCTGATGCACAACCACTA
CGGCTACTTCTCCCTCCCGGCGTCAGCGACCAATTATAACCACAGCTCCGGCGCCATGGC
GGACCAGGCGATTCGGAGGTTCTGCAAGGCGGAGGCGTCGACGGCGTGCTTCTCCGGCGC
CGACGCTGACGTGGATCCGGTGGTGGACGAGCTGCTCTCCTTCCCGGACTCCATCACGGA
CTACTCCTACATATGGAAGGCCTGACCAGATTAATTTCGTGGTTAATTTGCCATATGATC
GATCAGATTAATCCTGTTTAATTAGTTGGTTTATTAACTTGATTACTGTCAAAGGTTTGG
GTTAACTAGGAGATGATGATGATGGAGTTTGTGGTGATGCGAGAGAGAGAGAGATTAGGT
CGCGCTGATCTGGTCTGATCAAGGTGTGCAGAGCAGATGGAGCGGACTAATTCATTAATT
AGCTTAATCAAATTAGTTATATAGGTTTGTTTGTCTTAATTCTGTATGTATATAGTTATC
TGATTGGGGATAATACATAGAGATTACTAGCTAGCTAGCTAGTTTGGTGATTAGGGGGGT
GATGAGCTAGCTAGAGAGAGATATCTCATCAAAATTAAGGTCTCGGTTGGTTGATTAATC
TGCAGATTATATATTGCCTTGTGTGTGATAGGCCATGTGGCCTCTTTCTGTGTATGTGTG
TGTGTGGATGGAAGGAGTAAATTAACTAAACCCCTTGTACATGTACCATCAGTTGTGCTT
TACTTACATGATCAATTCAACCATTGATCGATTAACC

CDS

906 bp

>Os07t0684800-02 Similar to NAM / CUC2-like protein.
ATGTCGGAGTCGGAGGTGTCGGTGATCAACCAGCTGGAGGAGGAGGAGACTCGGCTGGAG
CTGCCGCCGGGGTTCCGGTTCCACCCCACCGACGAGGAGGTGGTGACCCACTACCTCACC
CGCAAGGCCCAGGACCGGAGCTTCTCCTGCGTCGTCATCGCCGACGTGAACCTCAACAAC
TGCGAGCCATGGGACCTCCCAAgcaaggcgaagatgggggagaaggagtggttcttcttc
tgccacaaggaccgcaagtacccgacggggatgaggacgaaccgggcgacggccagcggg
tactggaaggccaccgggaaggacaaggagatcttccgcggccgcggcctcctcgtcggc
atgaagaagacgctcgtcttctacatgggccgcgccccccgcggcgagaagaccccctgg
gtcatgcacgaataccgcctCGACGGCAAGCTTCCCCCCAACCTCCCCCGCTCCGCAAAG
GAGGAATGGGCGGTTTGCCGGGTGTTCAACAAAGACTTGGCGGCAAAGATTGCCCAAATG
CCGCCGCCTCCCTTCCCGCGCAACGACTCCTTCGACCTCGACCTCGACGACTTCCTCCAC
CTCGACGCCGACCTGCCGCCGCTCATCGACGACCCCTTCGCCTCCACCTCCACGCTCAAG
ACGGAGCCACCTCCGCCGGCCAACCTGATGCACAACCACTACGGCTACTTCTCCCTCCCG
GCGTCAGCGACCAATTATAACCACAGCTCCGGCGCCATGGCGGACCAGGCGATTCGGAGG
TTCTGCAAGGCGGAGGCGTCGACGGCGTGCTTCTCCGGCGCCGACGCTGACGTGGATCCG
GTGGTGGACGAGCTGCTCTCCTTCCCGGACTCCATCACGGACTACTCCTACATATGGAAG
GCCTGA

Protein

302 aa

>Os07t0684800-02 Similar to NAM / CUC2-like protein.
MSESEVSVINQLEEEETRLELPPGFRFHPTDEEVVTHYLTRKAQDRSFSCVVIADVNLNN
CEPWDLPSKAKMGEKEWFFFCHKDRKYPTGMRTNRATASGYWKATGKDKEIFRGRGLLVG
MKKTLVFYMGRAPRGEKTPWVMHEYRLDGKLPPNLPRSAKEEWAVCRVFNKDLAAKIAQM
PPPPFPRNDSFDLDLDDFLHLDADLPPLIDDPFASTSTLKTEPPPPANLMHNHYGYFSLP
ASATNYNHSSGAMADQAIRRFCKAEASTACFSGADADVDPVVDELLSFPDSITDYSYIWK
A*

5'UTR

chr07:29042109..29042127 (- strand) : 19 bp

CDS

chr07:29041907..29042108 (- strand) : 202 bp

chr07:29041532..29041809 (- strand) : 278 bp

chr07:29041004..29041429 (- strand) : 426 bp

3'UTR

chr07:29040452..29041003 (- strand) : 552 bp

FASTA

>Os07t0684800-02 class=Sequence position=chr07:29040452..29042127 (- strand)
TGGGGAGAGA GCAGGAGCCA TGTCGGAGTC GGAGGTGTCG GTGATCAACC AGCTGGAGGA GGAGGAGACT CGGCTGGAGC
TGCCGCCGGG GTTCCGGTTC CACCCCACCG ACGAGGAGGT GGTGACCCAC TACCTCACCC GCAAGGCCCA GGACCGGAGC
TTCTCCTGCG TCGTCATCGC CGACGTGAAC CTCAACAACT GCGAGCCATG GGACCTCCCA AGTAAGTAGT AGTCTCTCGT
TCATGGCGGC CTAGCTTCCT CATCGTCTGC TAGCTATTCG ATCCGATTCG ACGATGGAGC TGCatgcatg tattgcaggc
aaggcgaaga tgggggagaa ggagtggttc ttcttctgcc acaaggaccg caagtacccg acggggatga ggacgaaccg
ggcgacggcc agcgggtact ggaaggccac cgggaaggac aaggagatct tccgcggccg cggcctcctc gtcggcatga
agaagacgct cgtcttctac atgggccgcg ccccccgcgg cgagaagacc ccctgggtca tgcacgaata ccgcctCGAC
GGCAAGCTTC CCCCCAACCT CCCCCGCTCC GCAAAGGTAT TCTCTACTCG CCGCCGGCCA TGGCGATGGC TAGCTCACAT
GTCGCGTCGT TCCTCTTTCT CTTTTATTGA ATACTAGTAT ATGGTTGCGT GCGCGCAGGA GGAATGGGCG GTTTGCCGGG
TGTTCAACAA AGACTTGGCG GCAAAGATTG CCCAAATGCC GCCGCCTCCC TTCCCGCGCA ACGACTCCTT CGACCTCGAC
CTCGACGACT TCCTCCACCT CGACGCCGAC CTGCCGCCGC TCATCGACGA CCCCTTCGCC TCCACCTCCA CGCTCAAGAC
GGAGCCACCT CCGCCGGCCA ACCTGATGCA CAACCACTAC GGCTACTTCT CCCTCCCGGC GTCAGCGACC AATTATAACC
ACAGCTCCGG CGCCATGGCG GACCAGGCGA TTCGGAGGTT CTGCAAGGCG GAGGCGTCGA CGGCGTGCTT CTCCGGCGCC
GACGCTGACG TGGATCCGGT GGTGGACGAG CTGCTCTCCT TCCCGGACTC CATCACGGAC TACTCCTACA TATGGAAGGC
CTGACCAGAT TAATTTCGTG GTTAATTTGC CATATGATCG ATCAGATTAA TCCTGTTTAA TTAGTTGGTT TATTAACTTG
ATTACTGTCA AAGGTTTGGG TTAACTAGGA GATGATGATG ATGGAGTTTG TGGTGATGCG AGAGAGAGAG AGATTAGGTC
GCGCTGATCT GGTCTGATCA AGGTGTGCAG AGCAGATGGA GCGGACTAAT TCATTAATTA GCTTAATCAA ATTAGTTATA
TAGGTTTGTT TGTCTTAATT CTGTATGTAT ATAGTTATCT GATTGGGGAT AATACATAGA GATTACTAGC TAGCTAGCTA
GTTTGGTGAT TAGGGGGGTG ATGAGCTAGC TAGAGAGAGA TATCTCATCA AAATTAAGGT CTCGGTTGGT TGATTAATCT
GCAGATTATA TATTGCCTTG TGTGTGATAG GCCATGTGGC CTCTTTCTGT GTATGTGTGT GTGTGGATGG AAGGAGTAAA
TTAACTAAAC CCCTTGTACA TGTACCATCA GTTGTGCTTT ACTTACATGA TCAATTCAAC CATTGATCGA TTAACC

Locus: Os07g0684800

Loading...

Locus: Os07g0684800

Loading...