Os07t0689600-01

Locus

Os07g0689600

Description

Nicotianamine synthase 3, Mitigation of excess Fe stress, Fe detoxification, Transport of iron

RAP-DB Gene Symbol Synonym(s)

OsNAS3

RAP-DB Gene Name Synonym(s)

Nicotianamine synthase 3, NA synthase 3

CGSNL Gene Symbol

NAS3

CGSNL Gene Name

NICOTIANAMINE SYNTHASE 3

Oryzabase Gene Symbol Synonym(s)

OsNAS3

Oryzabase Gene Name Synonym(s)

rice nicotianamine synthase3, NA synthase gene 3, Nicotianamine synthase 3, S-adenosyl-L-methionine:S-adenosyl-L-methionine:S-adenosyl-methionine 3-amino-3-carboxypropyltransferase 3

Transcript Evidence

AK070656

Protein Evidence

Q0D3F2

Literature

PMID: 31231401

PMID: 14617093

Note

Manual Curation

May 27, 2020

Gene Ontology (GO)

Biological Process: nicotianamine biosynthetic process (GO:0030418)

Molecular Function: nicotianamine synthase activity (GO:0030410)

Functional domain (InterPro)

S-adenosyl-L-methionine-dependent methyltransferase (IPR029063)

Nicotianamine synthase (IPR004298)

Full-length cDNA

J023055E24 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0689600-01)

RiceXPro (AK070656)

Others

Oryzabase (3122)

KEGG (Os07t0689600-01 (EC:2.5.1.43))

Transcript

1510 bp

>Os07t0689600-01 Nicotianamine synthase 3, Mitigation of excess Fe stress, Fe detoxification, Transport of iron
TCCAATCCAAAAGTATAATCAAGCAAAGCAGCTCGATCGAGTGTTCGACTGATCACCAGT
TGGAGCTAATCGATCGAGAGAGAGAGTATGACGGTGGAAGTGGAGGCGGTGACCATGGCG
AAGGAGGAGCAGCCGGAGGAGGAGGAGGTGATCGAGAAGTTGGTTGAGAAGATCACCGGG
CTGGCGGCGGCCATCGGCAAGCTGCCGTCGCTGAGCCCGTCGCCGGAGGTGAACGCGCTG
TTCACGGAGCTGGTGATGACCTGCATCCCGCCCAGCAGCGTGGACGTGGAGCAGCTGGGG
GCGGAGGCGCAGGACATGCGCGGCCGCCTCATCCGCCTCTGCGCCGACGCCGAGGGCCAC
CTCGAGGCGCACTACTCCGACGTCCTCGCCGCCCACGACAACCCGCTCGACCACCTCGCC
CTCTTCCCCTACTTCAACAACTACATCCAGCTCGCCCAGCTCGAGTACGCCCTCCTCGCC
CGCCACCTCCCCGCCGCCCCGCCGCCCTCCCGCCTCGCCTTCCTCGGCTCCGGCCCGCTC
CCGCTCAGCTCCCTCGTCCTCGCCGCCCGCCACCTCCCCGCCGCCTCCTTCCACAACTAC
GACATCTGCGCCGACGCCAACCGCCGCGCCAGCCGCCTCGTCCGCGCCGACCGCGACCTG
TCCGCGCGCATGGCCTTCCACACCTCCGACGTCGCCCACGTCACCACCGACCTCGCCGCC
TACGACGTCGTGTTCCTGGCGGCGCTGGTGGGTATGGCCGCCGAGGAGAAGGCGCGCATG
GTGGAGCACCTCGGGAAGCACATGGCGCCCGGCGCCGCCCTGGTGGTGCGGAGCGCGCAC
GGCGCCCGGGGATTCCTGTACCCCGTGGTGGACCCGGAGGAGATCCGCCGCGGCGGCTTC
GACGTGCTCGCCGTGCACCACCCGGAGGGCGAGGTGATCAACTCCGTCATCATCGCGCGC
AAGCCGCCCGTGGCGGCGCCGGCGTTGGAGGGAGGAGACGCGCACGCGCACGGCCATGGC
GCCGTGGTGAGCCGTCCATGCCAGCGCTGCGAGATGGAGGCGAGGGCGCACCAGAAGATG
GAGGACATGTCCGCCATGGAGAAGCTGCCCTCCTCGTAGGCAGGCATCGATGACTGCTTC
CATCGCTTGCTACCTCACCAGCTCACCTGATAAATCACCTCAGTTACTATCGATTAATCA
TTTACCATGCATTAATTAAGAAGAAAACATATATACCATAATTATCTACCAGTAAAACAA
ATCTAATAGTAGTATTTAATAATCTCGTTGGTAATTAACTGCAGTCATGCATGAATGCAT
GCCATATTGCGTCGCTATCTTTTTTTCCCATGATGAGACTGATGAGAGAGAGAGAGAATA
TATGTCGCTATTGAGTGTTACTGCTTGATTACTGTACTAGTAGCTTATTACAATCAACCA
TTGTCTCTGTTGCGTATTTATGAGTGTAAGTGGTTAATTTTCTGTTGCAGCATAATTAAG
TTACCTGTAT

CDS

1032 bp

>Os07t0689600-01 Nicotianamine synthase 3, Mitigation of excess Fe stress, Fe detoxification, Transport of iron
ATGACGGTGGAAGTGGAGGCGGTGACCATGGCGAAGGAGGAGCAGCCGGAGGAGGAGGAG
GTGATCGAGAAGTTGGTTGAGAAGATCACCGGGCTGGCGGCGGCCATCGGCAAGCTGCCG
TCGCTGAGCCCGTCGCCGGAGGTGAACGCGCTGTTCACGGAGCTGGTGATGACCTGCATC
CCGCCCAGCAGCGTGGACGTGGAGCAGCTGGGGGCGGAGGCGCAGGACATGCGCGGCCGC
CTCATCCGCCTCTGCGCCGACGCCGAGGGCCACCTCGAGGCGCACTACTCCGACGTCCTC
GCCGCCCACGACAACCCGCTCGACCACCTCGCCCTCTTCCCCTACTTCAACAACTACATC
CAGCTCGCCCAGCTCGAGTACGCCCTCCTCGCCCGCCACCTCCCCGCCGCCCCGCCGCCC
TCCCGCCTCGCCTTCCTCGGCTCCGGCCCGCTCCCGCTCAGCTCCCTCGTCCTCGCCGCC
CGCCACCTCCCCGCCGCCTCCTTCCACAACTACGACATCTGCGCCGACGCCAACCGCCGC
GCCAGCCGCCTCGTCCGCGCCGACCGCGACCTGTCCGCGCGCATGGCCTTCCACACCTCC
GACGTCGCCCACGTCACCACCGACCTCGCCGCCTACGACGTCGTGTTCCTGGCGGCGCTG
GTGGGTATGGCCGCCGAGGAGAAGGCGCGCATGGTGGAGCACCTCGGGAAGCACATGGCG
CCCGGCGCCGCCCTGGTGGTGCGGAGCGCGCACGGCGCCCGGGGATTCCTGTACCCCGTG
GTGGACCCGGAGGAGATCCGCCGCGGCGGCTTCGACGTGCTCGCCGTGCACCACCCGGAG
GGCGAGGTGATCAACTCCGTCATCATCGCGCGCAAGCCGCCCGTGGCGGCGCCGGCGTTG
GAGGGAGGAGACGCGCACGCGCACGGCCATGGCGCCGTGGTGAGCCGTCCATGCCAGCGC
TGCGAGATGGAGGCGAGGGCGCACCAGAAGATGGAGGACATGTCCGCCATGGAGAAGCTG
CCCTCCTCGTAG

Protein

343 aa

>Os07t0689600-01 Nicotianamine synthase 3, Mitigation of excess Fe stress, Fe detoxification, Transport of iron
MTVEVEAVTMAKEEQPEEEEVIEKLVEKITGLAAAIGKLPSLSPSPEVNALFTELVMTCI
PPSSVDVEQLGAEAQDMRGRLIRLCADAEGHLEAHYSDVLAAHDNPLDHLALFPYFNNYI
QLAQLEYALLARHLPAAPPPSRLAFLGSGPLPLSSLVLAARHLPAASFHNYDICADANRR
ASRLVRADRDLSARMAFHTSDVAHVTTDLAAYDVVFLAALVGMAAEEKARMVEHLGKHMA
PGAALVVRSAHGARGFLYPVVDPEEIRRGGFDVLAVHHPEGEVINSVIIARKPPVAAPAL
EGGDAHAHGHGAVVSRPCQRCEMEARAHQKMEDMSAMEKLPSS*

5'UTR

chr07:29323098..29323184 (+ strand) : 87 bp

CDS

chr07:29323185..29324216 (+ strand) : 1032 bp

3'UTR

chr07:29324217..29324607 (+ strand) : 391 bp

FASTA

>Os07t0689600-01 class=Sequence position=chr07:29323098..29324607 (+ strand)
TCCAATCCAA AAGTATAATC AAGCAAAGCA GCTCGATCGA GTGTTCGACT GATCACCAGT TGGAGCTAAT CGATCGAGAG
AGAGAGTATG ACGGTGGAAG TGGAGGCGGT GACCATGGCG AAGGAGGAGC AGCCGGAGGA GGAGGAGGTG ATCGAGAAGT
TGGTTGAGAA GATCACCGGG CTGGCGGCGG CCATCGGCAA GCTGCCGTCG CTGAGCCCGT CGCCGGAGGT GAACGCGCTG
TTCACGGAGC TGGTGATGAC CTGCATCCCG CCCAGCAGCG TGGACGTGGA GCAGCTGGGG GCGGAGGCGC AGGACATGCG
CGGCCGCCTC ATCCGCCTCT GCGCCGACGC CGAGGGCCAC CTCGAGGCGC ACTACTCCGA CGTCCTCGCC GCCCACGACA
ACCCGCTCGA CCACCTCGCC CTCTTCCCCT ACTTCAACAA CTACATCCAG CTCGCCCAGC TCGAGTACGC CCTCCTCGCC
CGCCACCTCC CCGCCGCCCC GCCGCCCTCC CGCCTCGCCT TCCTCGGCTC CGGCCCGCTC CCGCTCAGCT CCCTCGTCCT
CGCCGCCCGC CACCTCCCCG CCGCCTCCTT CCACAACTAC GACATCTGCG CCGACGCCAA CCGCCGCGCC AGCCGCCTCG
TCCGCGCCGA CCGCGACCTG TCCGCGCGCA TGGCCTTCCA CACCTCCGAC GTCGCCCACG TCACCACCGA CCTCGCCGCC
TACGACGTCG TGTTCCTGGC GGCGCTGGTG GGTATGGCCG CCGAGGAGAA GGCGCGCATG GTGGAGCACC TCGGGAAGCA
CATGGCGCCC GGCGCCGCCC TGGTGGTGCG GAGCGCGCAC GGCGCCCGGG GATTCCTGTA CCCCGTGGTG GACCCGGAGG
AGATCCGCCG CGGCGGCTTC GACGTGCTCG CCGTGCACCA CCCGGAGGGC GAGGTGATCA ACTCCGTCAT CATCGCGCGC
AAGCCGCCCG TGGCGGCGCC GGCGTTGGAG GGAGGAGACG CGCACGCGCA CGGCCATGGC GCCGTGGTGA GCCGTCCATG
CCAGCGCTGC GAGATGGAGG CGAGGGCGCA CCAGAAGATG GAGGACATGT CCGCCATGGA GAAGCTGCCC TCCTCGTAGG
CAGGCATCGA TGACTGCTTC CATCGCTTGC TACCTCACCA GCTCACCTGA TAAATCACCT CAGTTACTAT CGATTAATCA
TTTACCATGC ATTAATTAAG AAGAAAACAT ATATACCATA ATTATCTACC AGTAAAACAA ATCTAATAGT AGTATTTAAT
AATCTCGTTG GTAATTAACT GCAGTCATGC ATGAATGCAT GCCATATTGC GTCGCTATCT TTTTTTCCCA TGATGAGACT
GATGAGAGAG AGAGAGAATA TATGTCGCTA TTGAGTGTTA CTGCTTGATT ACTGTACTAG TAGCTTATTA CAATCAACCA
TTGTCTCTGT TGCGTATTTA TGAGTGTAAG TGGTTAATTT TCTGTTGCAG CATAATTAAG TTACCTGTAT 

Locus: Os07g0689600

Loading...

Locus: Os07g0689600

Loading...