Os07t0695100-02

Locus

Os07g0695100

Description

Similar to Two-component response regulator-like PRR37.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HD2

CGSNL Gene Name

Heading date 2

Oryzabase Gene Symbol Synonym(s)

Hd2(t), Hd2, qHD2(t), OsPRR37, Os-PRR37, PRR37, Prr4, OsPRR4, DTH7, OsCCT28, Ghd7.1, PRR37/Hd2, EH7-2, EH7-2/Hd2, Hd2/PRR37, PRR37-1a, PRR37-1b, PRR37-1c, PRR37-2a, PRR37- 2, HD7.2

Oryzabase Gene Name Synonym(s)

Heading date (QTL)-2(t), Heading date 2, PSEUDO-RESPONSE REGULATOR 37, PSEUDO RESPONSE REGULATOR 37, pseudo-response regulator 4, Days to heading 7, Days to heading on chromosome 7, CCT domain-containing gene 28, CCT (CO, CO-LIKE and TOC1) domain protein 28, CCT domain protein 28, "grain number, plant height and heading date 7.1", Early heading7-2, Heading date 7.2

Transcript Evidence

AK059514 (DDBJ, Best hit)

Protein Evidence

Q0D3B6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CheY-like superfamily (IPR011006)

Full-length cDNA

001-029-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os07t0695100-02)

Others

Oryzabase (2274)

Transcript

726 bp

>Os07t0695100-02 Similar to Two-component response regulator-like PRR37.
CATCCAGAAGAAGACTATCAAAGTCTTGCTAGTTGATAGCGATGACTCCACCAGGCAGGT
GGTCAGTGCCCTGCTTCGTCACTGCATGTATGAAGTCATCCCTGCTGAAAATGGCCAGCA
AGCATGGACATATCTAGAAGATATGCAAAACAGCATTGATCTTGTTTTGACAGAGGTTGT
TATGCCTGGTGTATCTGGAATTTCTCTATTGAGTAGGATCATGAACCACAATATTTGCAA
GAATATTCCAGTGATTATGATGTCTTCAAATGATGCTATGGGTACAGTTTTTAAGTGTTT
GTCAAAGGGCGCTGTTGACTTCTTAGTCAAGCCCATACGTAAGAATGAACTTAAGAACCT
ATGGCAGCATGTGTGGAGACGGTGCCACAGCTCCAGTGGCAGTGGAAGTGAAAGTGGCAT
TCAGACACAAAAGTGTGCCAAATCAAAAAGTGGGGATGAATCCAATAATAACAATGGCAG
CAATGACGATGATGACGACGATGGTGTAATCATGGGACTTAATGCAAGAGATGGCAGTGA
TAACGGCAGTGGCACTCAAGCGCAGAGCTCATGGACAAAGCGCGCTGTTGAGATTGACAG
TCCACAGGCTATGTCTCCAGATCAATTAGCTGATCCACCTGATAGCACTTGTGCACAAGT
GATCCACCTGAAGTCAGATATATGCAGCAATAGATGGTTACCATGTACAAGCAACAAAAA
TTCCAA

CDS

725 bp

>Os07t0695100-02 Similar to Two-component response regulator-like PRR37.
ATCCAGAAGAAGACTATCAAAGTCTTGCTAGTTGATAGCGATGACTCCACCAGGCAGGTG
GTCAGTGCCCTGCTTCGTCACTGCATGTATGAAGTCATCCCTGCTGAAAATGGCCAGCAA
GCATGGACATATCTAGAAGATATGCAAAACAGCATTGATCTTGTTTTGACAGAGGTTGTT
ATGCCTGGTGTATCTGGAATTTCTCTATTGAGTAGGATCATGAACCACAATATTTGCAAG
AATATTCCAGTGATTATGATGTCTTCAAATGATGCTATGGGTACAGTTTTTAAGTGTTTG
TCAAAGGGCGCTGTTGACTTCTTAGTCAAGCCCATACGTAAGAATGAACTTAAGAACCTA
TGGCAGCATGTGTGGAGACGGTGCCACAGCTCCAGTGGCAGTGGAAGTGAAAGTGGCATT
CAGACACAAAAGTGTGCCAAATCAAAAAGTGGGGATGAATCCAATAATAACAATGGCAGC
AATGACGATGATGACGACGATGGTGTAATCATGGGACTTAATGCAAGAGATGGCAGTGAT
AACGGCAGTGGCACTCAAGCGCAGAGCTCATGGACAAAGCGCGCTGTTGAGATTGACAGT
CCACAGGCTATGTCTCCAGATCAATTAGCTGATCCACCTGATAGCACTTGTGCACAAGTG
ATCCACCTGAAGTCAGATATATGCAGCAATAGATGGTTACCATGTACAAGCAACAAAAAT
TCCAA

Protein

241 aa

>Os07t0695100-02 Similar to Two-component response regulator-like PRR37.
IQKKTIKVLLVDSDDSTRQVVSALLRHCMYEVIPAENGQQAWTYLEDMQNSIDLVLTEVV
MPGVSGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKPIRKNELKNL
WQHVWRRCHSSSGSGSESGIQTQKCAKSKSGDESNNNNGSNDDDDDDGVIMGLNARDGSD
NGSGTQAQSSWTKRAVEIDSPQAMSPDQLADPPDSTCAQVIHLKSDICSNRWLPCTSNKN
S

5'UTR

chr07:29617597..29617597 (+ strand) : 1 bp

CDS

chr07:29617598..29617691 (+ strand) : 94 bp

chr07:29623154..29623315 (+ strand) : 162 bp

chr07:29623426..29623559 (+ strand) : 134 bp

chr07:29623695..29623862 (+ strand) : 168 bp

chr07:29626395..29626561 (+ strand) : 167 bp

FASTA

>Os07t0695100-02 class=Sequence position=chr07:29617597..29626561 (+ strand)
CATCCAGAAG AAGACTATCA AAGTCTTGCT AGTTGATAGC GATGACTCCA CCAGGCAGGT GGTCAGTGCC CTGCTTCGTC
ACTGCATGTA TGAAGGTCTG TCTCTTCTTT CCTCCTTCTA CCTTCTCACT TCTGTCTATT TATTTATATG TTTGCCTTTT
TCACAACATA TTTTCCTATT ATTACTTACT ATCTGACTCT CAAACTGTTA ATTTTTCTGC TCCTCATCTC TGTTTAATCA
CACGTACCGC CTCTGCTTTA CAATTTGCTG TAGTGATTTT ATCCGGAAAC TATCTTCTTA AGGATTGTAC CAAACACATT
TTTCACCACA AATTAGACGA TTGTCAAGTT CAGAACAAGA TTTTGAACAC CTACATCACA AGGACGATAA GCAAGCAACA
AGATCATTTG GTACATAAAT CTGTTGAATA CTTTGTTTTG AAACATAAAG TATGCTGTTC CAAAGTCTTG TTTGAGAGAC
TGACTTGAAC CCTGCAAAAT CCATGCACAC TTTGTCATGC TAGCCGCTAA AGCCAAATTT AAACTAGGCC TGATTAGGTC
AACTGGAAAC TCCTTCTGAT TTTTTTTTGT TGAAAAAAGG GGTGCAGATT GTGGTACTGA TAATCATCTC AAGGTCCTCC
TTTTTTTTTC TACTGAAATC ATGTCAAGGT CCTTGAACGG ACACGTTACC AAATCAATTT GTTGAAGAAG GGAGAGATAA
CTTTTTAATC CAAGATTAAT CTCCACGTTG TATGAGAGGC CACCTTGAAT TGATGGTTTC TAATGATTTT GGGTTTTCTT
TTTTATTTCA ATACTTGTAT GAATTTCTAG TGCCAATATT TTGGACCAAT GCTCTTGTAT TCCTTATCTT TAATTTGGAT
GCAACTTTTC CATTGGATAC ATCAAACGAG AATGAAGTCA TAGGGATAGT TTGTTGTTGT TGTGTTGTGT TGGATACCTC
CTTTTGGCAC CCAGTTCACC TTCTTCTTGT AAGCCAATGG GTACCACCTA GAATCTCCAG CCATCTGTGG ACAGCACTAT
ATATTGCAGG CTTGTTTTCT TCAAAGTATT TTTATGCCTT CCCTGTCTTC GTATCATATT GATGTATGAT TTTGGACTGG
AAAATGATTT GATTCTATTT CGATCGCTAG CCTACTGTTA GGTTTGTCCT ATTCTGCTGC TTTGGTGTGG TTGCTTCAGC
TCATGAAGGG GGTTGCTGCG GATGGGCACA TCAAAACCAT TTCTTTTTCA TTCCATTGGT AGCATCACTT CTGGGGAGCG
ACCATCAAAT GCTACGTAGA CAACCATACC TTGTCCTTCT CCCTTGGTTG TTGGCCATGG GAGAATTGTT TTCATTGCCT
AAGCCAGAGG GTCCTTTTCA TCGCATGTTG GAAAGTCCAG CTATGCAGTA GCCCGAAACT CCTCTTCTGC CACCCAACAT
TGCCTCCCTA CAGGTGACAT GTGCCAAATG GCGACGGCAG CAAGACTAGA CCACCCAGCT TGGCGATAGG AATTGGAGGT
TGTCGGCCTC TTCTTGTATG TGGGGTGGCA GATTTACTGC CACCACCATT AGAGTCTGTT TAAAAGAGTA TATATACTTG
GACATCAAAA AGCACATGCT AGATTACATG AAAGTAGGAA AAGTCTAGGT AGCTCAATGA AGGTTTTGTT ATAACATGGT
CAAGTAAGGG TGTAGGGCCT GATTACAGGG CACTCCCAAT TTGATTGATG AGTACTTCTA CAGTGCTCTC TGAATACTAC
AAGTATTGTT ACCAATAGAA GCGATAGAAG TCAGTGATTT ATGAGTTCTA CTACCACTAG AAAAAAAATT TCTGCTACCA
GTAGTTGAGG TGGTAGCATA AATAGATATG GCCCATTGGA TGAGAAAAGA TGACAGGACT AGATTGATTT TACTACCAGT
AAAAACCACC GAATAAAGTT TCTAACTATT CTTTCCTCAC ACTATTGAGA AGAAGGCACT TCCATTAAAA AGGAAAACAT
TTTCGATATC AAGGCATCAA TTTGTTTTTC ATTAAAAAGG AAACTGAATG AGGGGATAAA AACCTTCCGT TGGGCTTTGC
ATGCGAATAG TCTAATAAAT ACTCCCTCTG TTTTCTTTTA TTTGACACCT TTGACTCCAC ACACAAAACT AGGCAATCAT
TGTACTTTCT AGAGATGACT ATTTTACTCT TAGAGAAATT TAGTGTTGTT GGTAGGGTAT GCTCACACAA GAACTTTCTA
GATTAGTGTG GATGAATACA TAGTTGTTTC TTATAAGGGC AAAATGGGAA AATAAAGATT GAGTTTCGTG CCGTGCCAAT
TATTTGCAAA CAACTTTGGT CAAAGTTGTC TAATTAAAAG AGAACTGAGG GAGTAAAGAA TTCTAGCTCA GCCTAGGAAA
GTAGAGCCAA CAACATAAGT CAATGAGTCC ATGTTGCTTT TGAGCCAACT AATTGAGCAA CAAGTTTGGC ATCTACTACA
AAAGAGAGAA TAACCATGTG AGAAGGGTAT ATCATTTAGT AGGAAGGGTA TATCCTGGAA TACCTCGCTT GACCTCTTTC
AAATGATTGT CTTGGCTTGG CTTCGGTTTA GCTGGCACAT TTATTAGGAG GAAGGGTTTC TTGGAGCTTT TCTTCATTGC
TTGCTGGCAC ATTTGGAAAC AGCGTAATGA AAAGATTTTT CAGCATATTG ATCCTTCTTT GATGCCTGGT GGTCTGCCTT
TCAGACATGA GATTCTCCTA TATAACTATA GGATGAATGG CCCCTACGAC AAATAGTTGT TGATTGGTTA CTACTTTTGT
AGTTCTTTGG TTTTTGTTTT TGCCTTTTAT GTACATATTC CTATAAAACT TTTTTGTTCT CTGACATGGG GTAGTTCTTC
CCCTAAAACA AACACTCAAT TCACCGGTCT GACCTGTGGA CCGGCTGGTT GAATCATGGT TCAATAGCGT ATATATACAT
TGTATATTCT CTGTAGATCA CAAGGGAAGA ATGACAGGAA TGGTAGGCTA AAGCTCAGAG TTCTCAGTGC ACGGACCTGA
GTTCAAGTCC CCATGCCACA ACCTTTTCTA GGATTTTTAT TAAAAAAACA GAAGGCATAA ATTGGGCCTT GATGTGGCCC
ATTTATCTCT GCACGGTTCA ACCGGGGCAG TTTAATGTCC AATTTAGCTT AAACTAGGCC GGTCCGCCCA GTCCAATCCA
GCTCAAATGC ATGTTCGGTC TTTGAGTGCA ACCGTGGCGA CCTTTTGTTC TGTTTTTTTA GGTCGACTTG TTGACCCGGT
TCAGTTTTTT TACACTATGA CGCCTGGAGA TACAACTGCT GGGCTAAAAT GGGTTGAGCA ACTGTCGAGT TGGCCTGAGC
AAAGGAAGGG CCCACACAAC TCTGCCCATG TTTCTGGAAA GAGAATCATC GCTCCGATTC TTCTCTCTTC TAGGCTAGTT
TGAGCAATTC CCAGGTCAGC TCATAACAAT GTGATATCAG AGCTCGTCAA TCCTAGAGAA GTCGTGATTC CGAACACGTA
TGCAGCAACA GGTCGAGGAT ATGGATTTTA GGAAAGTATT CCAAACACAT AAGTGTGGGC CTTTCCTTGC TCGGCCCAAC
CCATCGGTTG CTTGACCCAT TTCATCAGTT GACCCAAGAA TTGTATTTCT AGGTGTATGT GGGTCCGCTA TACGTGAGAG
TGAAATCTAG ATTTTGGAGG CACCGAGGCA GGGTGTGATA TCAAGATTGT AATCCTACTC ATGAGTAATA CAATGAACAT
ATCTTGATTG TTTTAAAAAA ACCGACAAGG CTGTGATGTT CTTTTCACAA AAAGAAAGAA AGAAAAGAAG ACGCCAATGT
TGTGCTGGTC TTTTGGCCTG TAATGGCTCT TTATGGACGA GAACATTGTT ATTAAGCTAT TGTTGCTGGT GACTTGTCTA
GAACACACTA CACATACACT CTCCTCGGAA ATTTCATTAG CCACAAGTGT TAGCACCTCC AACCTAATCC CATCCTGAAG
GACCTAGAAC TTGATTTTAT CCATTATCTA AAAAGAAAGG ACCTAGAACT TGCCTTCCCA CAGAAAGGAA TTACGAGGGT
CTTGTCATGT TGCTAGCCGA TGATAATATC TGCCAAATAT TCTTGAAGTG CAGGAAGTTA CCCTTGTAAG CATCGAAGAA
ACAGGATCCT AAGTGCCTCG CAAGCTTGTG CACAACATGA CCCAATGGTT GGAATAGTGG CAAACACCGG ACTAAAATTT
AGTATAGACT AGTCCACTGG TTTGACATAT GCTTGTTCTC AGTCTGACTA TATTGGGGAG TAAAGGTTTT TTTTTTCATA
TTTCAACATT AGAAACTTTA AATTGTTGGT CTAGTACTCA TACTTGgctg tgttcgcata tgtgggttgg gaactcattc
cctccgcatg gaaaacggag tggtccatta gcacgtgatt aattaagtat tagctatttt tttcaaaaat ggattaattt
gattttttta agcaactttc gtatagaaac tttttacaaa aacataccgt ttagcaattt gaaaagcgtg catgtggaaa
aCGAGGGAGA AGGGTTGGGA AAAGGGGATG CCGAACACAG CCTTAAGTTT GTTGGTCGCA CTGTACCCAA GCATGTGGAG
CTTTGATTTC CTTCAGTCTG TACAATTTTG GGTGAGATAT GCACAACAGC ACAAGATAAA TATAGCGTGT TCTAATATTT
TAACTCACCC GCTAATTTAC CCAGCTGCCA ATATTTTTCA TGATTGACGT AGCCTGTACA AATTCGATCC TTATTTTTTG
TAATTTGTTA TGGACTAGCT AGGGTAAGGG TTTGAATACA AGGTGCTCCG TGGGAACCAT TAATGGCATC AGATGGACCT
TTTTATACTG GAGTTTGAAT GTTTGGGGAA TAGACAAGAG ACTTATGCAT CATTTTATTG AGAAGGAAAG GGTCTGGTAT
AAATCCAAAA AATGAAAAAC AAAACAACAA AGAAACTAGA AATGTCAAAT GTGGTGGGTG GTGGTGAATA ATGCTGCTTG
CTAGCGGGAG ATGCCTGCCC ATTGGCTATC TCTCGCAAAA TGATAGTGTG ACCAAGAAAA GATAAAGCAC TCTATGCCTT
GAGCTGTGGG ATCATCACTC CAGTCCAGCA GCACTTGATC CTTTTTTTCT CATTGCAGGC ATTATATTCA ATTTGCTAAC
GACTTTAACT GAGATCACTG ATTTATGGTC CCCATTCTTT GACTAAAACT CATTTCTGCA TTGTGCACTT GCTTGCTGTT
TCAAGTATTA TTCATATTTC TTGTGGATCT TCCATTCGAT TATACTCTTG TTTATTCGGC TTCTTTGTTA AGGACAGGGA
GCCAAGCACA CTAGAGTAAT ATTCTGAATG CAGACTGGCT TTTGTGACCT TTGTCGGCCC CGGTTTTGGG TGCTTCTTCT
TAGTTGCAAT ACCTCGGGGA AGTTCTTTCC CCTTGGGGCC AAGGTTTTTT TTTAATGCAC AAGATATTTT ATCTTTGTTG
GTCTTTGACT GAGTGTTATT AATTTATTTC TGTGAAGTCA TCCCTGCTGA AAATGGCCAG CAAGCATGGA CATATCTAGA
AGATATGCAA AACAGCATTG ATCTTGTTTT GACAGAGGTT GTTATGCCTG GTGTATCTGG AATTTCTCTA TTGAGTAGGA
TCATGAACCA CAATATTTGC AAGAATATTC CAGTGATTAG TAAGTAGCTT TCCTCAACTC TACAGTACAA TTCTTGTACA
AAATGTTGCC CTTGTCATTT ATTTACTTTC TATGCTTTTA GCTGCTACAC TGTTGTGGTT TATGTGCAGT GATGTCTTCA
AATGATGCTA TGGGTACAGT TTTTAAGTGT TTGTCAAAGG GCGCTGTTGA CTTCTTAGTC AAGCCCATAC GTAAGAATGA
ACTTAAGAAC CTATGGCAGC ATGTGTGGAG ACGGTGCCAC AGCGTAAGTT GTTGTTGGTC CAGTTTTTCT TATATATTAG
ATGTTCAGGC AAATCCATCA AGTACTGACT GCTGCTTCAC CATTTTATGG TTACAATATG TGATGACTCT AAACTAAAGT
TGTTATTTTC AAATTCAGTC CAGTGGCAGT GGAAGTGAAA GTGGCATTCA GACACAAAAG TGTGCCAAAT CAAAAAGTGG
GGATGAATCC AATAATAACA ATGGCAGCAA TGACGATGAT GACGACGATG GTGTAATCAT GGGACTTAAT GCAAGAGATG
GCAGTGATAA CGGCAGTGGC ACTCAAGTAT GAAACTTGAT CTTTTTATTC CAACATAGCT TTACTACTAC CTGTTAACAA
AGCTGTAATT AGAATGAGAA GAAAAAACTG AAGTTAAAAA CTGAATAAAC CTGTCAGTAA CAATGATTTC TGAAGGCATA
AATGACATTT TTTTGCATAG CTGATAAATT TATTTTAGAA TAGTGGGAAA TAGGAAGAGT TCACCATGTC ACTGTAAAGT
TTTTGAATTA ACCAAACCAG TAAAATACCA TGGATCATCT GCATATAACA ATCTTAATAT TGTACAAACA CAACAGATGA
AACACATACT GAAGAAAATA TAGTTATCGC CTCTCGGATA GTTTACATGT GTGTTCATGT GGCACTATCG TTTTGCTTAA
CTAATACCAA GGTGCCAAAT AAACCAGCGG TTGGTTCATT GCATTTTGGA GCACATATAG TATTTATAAA TCTTGATAGC
GTGTGTGTAG AATGTTCCAC CAGAAGTTGA TAGCACTGTG CTTTTTGCAT GTTCAAGGAA TCAAATGGAT TGTACAATAC
ATGCAACCAA ACTTTGATGT AGGGAATTTC TTTGTTTTGG CTTGGATGTC CAACTTATAG TTTCTCACCA GTTGGATTAA
CTTCTTTTCC TTGTTCTCCC ATTGTAAACG TGAATTGAAC AATCCTTGCC TTTTAAGATA AATGTGGGGT CTATGCTTTA
TGCTGCCCTT TAAATTTTTG AAATGCTAAT AAGTAGTTTG CATGCATCGT GCTTCTCTAA ATGTCATCAA GTTGACTAAT
ATACAGTTCA CTATCAATCA GCTAATACCA CTTTATTTTA TGTGTTTCCT ATTATAAATT GAACATTTTG TTTCCTTACC
AACTAGAAAT CATAGTACAG ATACATATTG TATAGTTATT TTCGGTTTAT TCATGAATTT GTGTTAGAAT TAGACTATAT
AGACATTGCT GGTTAAAAAG TACTCATCCC CTAACACTGT GGGAAGAGTA CAAAACTACT AGTGTGTTAA CACCATTGGC
CTCTTGACAT TCAAAACTGC TACCCAATGA ACACATTCCC CATCAATGGT CCAATAATCC CGAAGTCTAA AGTCCTTAAT
CAACTCGTGC ATAATTATTC ACTTGGTAAG GAAATAGGAA AAGGATGGAT GCACACAAAT GTTTTGTCCA TTTTTGCTAA
GCCTCCAGTA TTTTTACTTC TGTGTTTTGA GCTTCATAAT GGTTTCCATG TCTTTTCTTC AATTAACGCT TTTGTCCTGT
ATTTTGATTT CTATTTGCAC CATTTAATGA ATCTTCCAAA TTTGGGTTTT TCCTCTTGAT GATTTTTAAC TTCACATCTC
AATTGATCTT TAAAATATGC CTAATTATTT AAtactacct ccgtcccaaa atatagcaac ctaagactgg ataggacata
tcctagtcca atgaatctgg acaacccttg tccagattcc ttggactagg atatgttcca tccaatccta aattgctata
ttttgggatg gagagagtaT CATCTAATTA ATTACCTGCA AATCTGCAAT GCTCTGCTTA AACATATTGT ATATTTTCTA
TACTAATTTA CTATACTTAT TATCAAAATG AAACGTATAT TAAAAATTAA ATATCTGCTG CAATATGTGC CCTCAAAACT
AGTATAAACA TATTGTATAT TTTCTTTTCA AAGTTACCTT TAATTTGGCG ACATGTTTGG ATTGATAAAA TCAAGTCTAA
GCTTGCAAAT TTGGTTCTCC TGATGCTGTA TGTTTGATTC CACTAAATAG ATTCTCTTCA ATGACCTAGG CAAGCTGTCG
TAGTTTATCC CAAATGTGTT GAAAAGGTTG TTCTGGGTAT CACCGTACAG ATAGATTGAT CCTGAAATTC GTATGCAGAG
TAAACAAAAT AGTCTTATCA ACATAGATAA TGCTAAACAT CATATCATCA GCGCACTAGT GCAGGACTGC CTTGACATAT
AATGGTTGCC TGAAATGGCA ATGAAATAAA AAATCTTTTA TTTAAAAAGC AAGATTCAAT TGTGAATTAG CAATAGTTGG
AGAAATTTAG AGTTACAGGA TATGGCACAC GAGGTGTACT TGAGAACTGT CGGTTTGTAG CTAGAGATGG CTACGAATGC
CGCCGGGGGG TACCTAGCTT ATCGGCGGTG GATGAAAACT AGTGTAAACT TGAAATTAGT CCACGTTTCA TGTGGATGAA
ATCTAGTGTA AACTTGAAAT TAGTCCACGT TTATTATGAA ACGTTGACTA CAGACCCTAC CGAGATAAAC TGTATCTTAT
GTGTTGCTGT CAAGTTCTCT TTTATTACAG TGTTGTGGAG TGGGGTAAAA TTTTTTTCCT GTCAGTTAGT TATGAATCAC
ATAAGATTTT GCCACTGAAA TGTTCAGTGA CATGGCCGAT ATGTCAATGT AAGAAACAAC TTAGAATAAA TTCCACATTA
CAATATTCAG AAATAATTAC TGTAGATCGG ATCACTTTGT GAAGTGCATT TAAACTGGTT GCTCATCATT TTTTTAAGGC
GCAGAGCTCA TGGACAAAGC GCGCTGTTGA GATTGACAGT CCACAGGCTA TGTCTCCAGA TCAATTAGCT GATCCACCTG
ATAGCACTTG TGCACAAGTG ATCCACCTGA AGTCAGATAT ATGCAGCAAT AGATGGTTAC CATGTACAAG CAACAAAAAT
TCCAA

Locus: Os07g0695100

Loading...

Locus: Os07g0695100

Loading...