Os08t0100200-00

Locus

Os08g0100200

Description

Similar to ZIP transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

XP_002299235.1 (RefSeq)

Literature

Note

Manual Curation

Expression Databases

TENOR (Os08t0100200-00)

Others

KEGG (Os08t0100200-00)

Transcript

858 bp

>Os08t0100200-00 Similar to ZIP transporter.
ATGGATCCCAAAGTTGTTGTTGCTCTCGCTCTGTCCCTTATTGGTGGCCTTAGCACCTCT
CTTGGTGCATTGCTGGCTATACTAAACTGTGCCCCAAACAACAAAACACTCGGGATGTTA
CAGGGTTTTGCTACTGGGCTCATGTTAAGCATGTCTTTCTTTGACTTGGCTTATGATGCT
GTCAACGCGATTGGTTTTCTAAAAGGAAACCTTTGGTTTTTTGCTGGGGCACTCCTGTTT
TCCACTATTGCTGAGGTTTTCCCTGAACCAGATTGCAATTTAGCAGATGAGAATGACAAA
CATTTGGAAAATAAGACTGGTAATAACAACATAGCAGGGAAGGAACTTATGATGAGACAC
CGCCGAAGAGTAATCTTTAGTGTCGTTGTCACAGCAATAGTTGCTGGTGTGAGTTTGCAA
AACTTCCCTGTGGGTACTGCGGCATTTCTTGGAACCACAAAGGGCTTCCGTGTTGGCCTT
AACTTGTCTCTTGCTATAGCTCTACACTACATCCCAGAGGTAATTGACTTTGTGGCGCCT
TTTGGGTGGAAGTGGGACTTGAGAATAGGTGTTGAAATTGGGAACAAATGGCAAGCCTTC
AAACTAGCGACGCTATCTGGTTTTGCAGAGCCACTAGGTGTAATTATCGTAGTGGGAGGG
GTCATGGCGTTTCTAACGTTATATGAAATGCTACCAATAGCATTTGAATACGCAGGACGC
AAGGATGCTGTGAAGGCTGTATTTGTTGGCATGGCTTTTATGTCCATGAGAGAGGTTCTC
AGAGAAAAAGAAAGACCTCCAGAGAATAATGTGGCTATGCCAAGCCAGTCTAACCAAAGT
GGCCCTTTTGGGCTATAA

CDS

858 bp

>Os08t0100200-00 Similar to ZIP transporter.
ATGGATCCCAAAGTTGTTGTTGCTCTCGCTCTGTCCCTTATTGGTGGCCTTAGCACCTCT
CTTGGTGCATTGCTGGCTATACTAAACTGTGCCCCAAACAACAAAACACTCGGGATGTTA
CAGGGTTTTGCTACTGGGCTCATGTTAAGCATGTCTTTCTTTGACTTGGCTTATGATGCT
GTCAACGCGATTGGTTTTCTAAAAGGAAACCTTTGGTTTTTTGCTGGGGCACTCCTGTTT
TCCACTATTGCTGAGGTTTTCCCTGAACCAGATTGCAATTTAGCAGATGAGAATGACAAA
CATTTGGAAAATAAGACTGGTAATAACAACATAGCAGGGAAGGAACTTATGATGAGACAC
CGCCGAAGAGTAATCTTTAGTGTCGTTGTCACAGCAATAGTTGCTGGTGTGAGTTTGCAA
AACTTCCCTGTGGGTACTGCGGCATTTCTTGGAACCACAAAGGGCTTCCGTGTTGGCCTT
AACTTGTCTCTTGCTATAGCTCTACACTACATCCCAGAGGTAATTGACTTTGTGGCGCCT
TTTGGGTGGAAGTGGGACTTGAGAATAGGTGTTGAAATTGGGAACAAATGGCAAGCCTTC
AAACTAGCGACGCTATCTGGTTTTGCAGAGCCACTAGGTGTAATTATCGTAGTGGGAGGG
GTCATGGCGTTTCTAACGTTATATGAAATGCTACCAATAGCATTTGAATACGCAGGACGC
AAGGATGCTGTGAAGGCTGTATTTGTTGGCATGGCTTTTATGTCCATGAGAGAGGTTCTC
AGAGAAAAAGAAAGACCTCCAGAGAATAATGTGGCTATGCCAAGCCAGTCTAACCAAAGT
GGCCCTTTTGGGCTATAA

Protein

285 aa

>Os08t0100200-00 Similar to ZIP transporter.
MDPKVVVALALSLIGGLSTSLGALLAILNCAPNNKTLGMLQGFATGLMLSMSFFDLAYDA
VNAIGFLKGNLWFFAGALLFSTIAEVFPEPDCNLADENDKHLENKTGNNNIAGKELMMRH
RRRVIFSVVVTAIVAGVSLQNFPVGTAAFLGTTKGFRVGLNLSLAIALHYIPEVIDFVAP
FGWKWDLRIGVEIGNKWQAFKLATLSGFAEPLGVIIVVGGVMAFLTLYEMLPIAFEYAGR
KDAVKAVFVGMAFMSMREVLREKERPPENNVAMPSQSNQSGPFGL*

CDS

chr08:24000..24063 (- strand) : 64 bp

chr08:23741..23799 (- strand) : 59 bp

chr08:23518..23610 (- strand) : 93 bp

chr08:23363..23449 (- strand) : 87 bp

chr08:23180..23276 (- strand) : 97 bp

chr08:22327..22388 (- strand) : 62 bp

chr08:21687..21808 (- strand) : 122 bp

chr08:21290..21357 (- strand) : 68 bp

chr08:20820..20937 (- strand) : 118 bp

chr08:18289..18376 (- strand) : 88 bp

FASTA

>Os08t0100200-00 class=Sequence position=chr08:18289..24063 (- strand)
ATGGATCCCA AAGTTGTTGT TGCTCTCGCT CTGTCCCTTA TTGGTGGCCT TAGCACCTCT CTTGGTATGC ATATATGCAC
TTCCCATCAC TCATTTTTCT TAGCTGTATG CACAGCCATG CAATTTTGTA CCTCAATTGG ACTTTTATGG TATTTTCTCT
TGAATTATTT TGGGATCAAT TTTGTAGTAA TTGAATGAGT ATGTTATACC TCTCGATAGC CATCACCTTC CTACTCCCGT
AATAGCTGTG TACTATTTCA TCAGGTGCAT TGCTGGCTAT ACTAAACTGT GCCCCAAACA ACAAAACACT CGGGATGTTA
CAGGTAGAGT ACAGCTATGT ATTATGTATT ACGGTCAAAC AACACCAGTT CATATTTGCA CTATGGGCAA GCTCATAAAA
CAACATAAGC TCATCTTTGC ACAAATCTAA CATTTTTACA TACTGTTTTT TAGGGTTTTG CTACTGGGCT CATGTTAAGC
ATGTCTTTCT TTGACTTGGC TTATGATGCT GTCAACGCGA TTGGTTTTCT AAAAGGAAAC CTTTGGGTGA GAGTAACCAA
TAAAAAGTCA AGGAACTGTA ACCTCTTCTT GTCTAATTAG CTTATGCATT GCAGTTTTTT GCTGGGGCAC TCCTGTTTTC
CACTATTGCT GAGGTTTTCC CTGAACCAGA TTGCAATTTA GCAGATGAGA ATGACAAACA TGTATAACCT CTCAACTTAG
TTCGCTAGCC AATTTCAGTT AGCCTTGGCT CAGAAACTAA TATAGGATTC ACCATTCTAT TTTTTAGTTG GAAAATAAGA
CTGGTAATAA CAACATAGCA GGGAAGGAAC TTATGATGAG ACACCGCCGA AGAGTAATCT TTAGTGTCGT TGTCACAGCA
ATAGGTAAGT CCAAAATGTA CCTTATGTAT TTTAATAGCT TGATAAAGAA TATGCTATAA TAAACTAATT GTACATTTAT
TGTTGATGCC ATCCTAGCAA ACTATGAATT GATTGCATCA ACACTTTGAC ACATTTATAT ACAGCCAACC TTGTGAGTCA
CAACAATTTA TAGCATGAAA GCAAATAAAA TTTTAATGTT GAACCTAAAT TAAGATGTAT ACTTATTGAA CCAAGATTAA
GATGTACTTA TTCAATAAAA TTATAATATT TAACCTACAT TAAGATATAC TTAATAATGA TGAATATATC ATAACATTTT
CCAGTTTTCT AACAACACAC AGATGACATA TTTCTGGATT GCATTATATA TATAACTAAC ATTTTAGTTC TGAACTCCAA
CATATTGACT CTTAATTATT CATAAGAGTA TGATTGCTAA TATTCAGCAT AAAAAAATCT GTAGCTTATT GGATAAGAAA
AAGAAAAAAG AGTAACATGT AGCTTTATAT AAACAACAGC TCAGATTGAA GTATTGAACA TCTAGAGGCA ACTCAAAATT
AGTAGTTTGT TTAGCCGTTA ATACAGAAAA TGATATTTCA CAACTTGTTC AGTACAACAA TTGATTTCTA TTTAAATAGC
TTGGATTCAA GTACACATAA TTTTACACAG TGAAAGAAAT GACATATAAG TAAAATATAT GCATACACAA CTAACTGTAT
GCCCTTTTCC TGCATGTTTG TTTGGTTTTA ATGGTTGCAC TTATGAACAA AATGTTCAAT TGTTCATATC AACAGTTGCT
GGTGTGAGTT TGCAAAACTT CCCTGTGGGT ACTGCGGCAT TTCTTGGAAC CACAAAGGTA TTTTTTTCTT ACTGTTTTCA
ATATTTATAA TAACTTATTC AGTGTTGTCA CTATGCCCAA CAAAGTTTCT CAATGATGGC CAAAGGCTTT TGAGGCATGG
AAGAAAATAT ATAACCAAGT ACAACATAAT TAAACAAACA AGCTGTATAT ATTCATCTTT GTGTTAAGTT GAACAAACAT
TCAACAATTA AATAGTAAAT ATGGTACAAA AACTATTCAT GTATGTACCT TTACAATTAT ATGCATTGTA GTAGATATTA
TTTTCCATGT ACCTTTCTCA TATTATCCAT ATTGACTACA GCCCACTCTA TTTTATTGAT AAGTATTTTT AGTCTCTCTA
GTATTTTCAT AAATGGATAG TGTGTAAAGG ATACCTTGCA TGCTAATGTT GACATGCATT TTATCCAGAC ACATGTTCAT
TTAGTGTATA ACATCACCAA TATATTTGAA TATGTAACCA GAAATTGAAT AGTAAAGGCT TATGATAAAG TTAATTAATC
TTATCTGCTT TTCAGGGCTT CCGTGTTGGC CTTAACTTGT CTCTTGCTAT AGCTCTACAC TACATCCCAG AGGTAATTGA
CTTTGTGGCG CCTTTTGGGT GGAAGTGGGA CTTGAGAATA GGTGTTGAAA TTGGGAAGTG TCTTCTCACC CATCCGCCCA
TCCCCTCTTT TTTGCCCATG GCCACTGTAA TTTTGCATTG AAGATACACA ATATTATACT TTCATGAATT TGTAGAGCTA
ATTGCAAATG GAGTGTAATT ATATTTTCTC CCACCACCCT GTTAAGACCA ATTGAATACT CTAATAGTTA TCGATATTTT
GTTCACGTGC AGGGTATTTC AGTAGCTCTC CCTGCGTACT TTGCCACTTG CAGGTACTAG TTAATATATT TAAGTAGACC
TGTTGTACTT CTGAAAAAAA TAGCCCTGCA GTTCTAGTAA AATTATGTTT GTCACGTCTG ATGCAGCAAA TGGCAAGCCT
TCAAACTAGC GACGCTATCT GGTTTTGCAG AGCCACTAGG TGTAATTATC GTAGGTAGGT TCACTGATTT AAATTATTGC
ACAATAATAC GTGATTTGTG CACATAGATG TTACCAATTA CCAAAACTAG ATGTGTTCTT AAATTTTAAC ACTTCCATAT
TAACTATAAC CAGAAATACT AACATTGACA GGCTGAGTTC ATACACTTCA TTCTATTGCC ATCATTCTAT GTATTCAAAT
AATGCATATG AAATGTAAGT TTCTTGCAGC ATACCTATTC CCAAGCAACT TGAATCCTGA AATATTGGAA GGCCTACTTG
GATTAGGTAA CCAAATTAAC AGAAATTTAT TTTGAAAAAT AGCTCAACTT AAGTGTTTAA TAGTTTCATA AATTTTCTTT
GCACAGTGGG AGGGGTCATG GCGTTTCTAA CGTTATATGA AATGCTACCA ATAGCATTTG AATACGCAGG ACGCAAGGAT
GCTGTGAAGG CTGTATTTGT TGGCATGGCT TTTATGTCCA TGAGGTGTGT TACAGTCTTA CTACTGCGGT GAACAATTAA
TTTTACATAA GACACTACCA GTACCGGTTT ATAATTTTTC TGTTCAATAA TATGACCGCG ATACTTATTT CGGCCACCCA
AGATACCTAC CGCACCTTGG ACAGAAAAAA AATAATTTGA TAGATGTTGG TCAATGTGGC TGATTTAGCA AGAAATATTT
AGCAGAGATT GGTTATAACA AAATATTGCG TTCAAAATTT GGGTTATGGC ATAGGGGGTG CACATTCGCT AAGGCAGGCA
TGAGCGCATG AGGATGGACA CATATGGATT AGTTCCACAT CACTTAGCAG CACTGCAGCA GTGACCAACA TATAAGCCCA
AGAGTACCAT ACCCCAGAGT TAACAATTTT AACAAGTGAA ACAAGGATGA AAATACTAAG CAAAGTTGGT GTAAGTGCAT
GGCTTATTTG ACACGGACCC TAGGTGTCAC AGTAGGCCAA TATGGTATGT ATGTATATAT GGATCAGGAG TTATTAACAC
AAAATTTCCA GTCAAAATCA GCAAAGTATT TAGAAATACA TGGTGTATAA GATCTTAAAT TCAATGAACT GTTTTTGGAA
GATTGTAATA TAATGTAATG AATGTTATTA TATCATGAGC CTACTTCAAG AATGGGCAAC AACTATCAGA AGAGGACATG
CAACATGGCT TGAGGGAGAA AGATCAAAGA GAACAAAGGG ACGGGGCTTA GTGGAGAGGA ATAAGCTAGA TTATGAACTT
TTTAATTCAT TATTATTACT TGCACACTCA GAGGGAGATG ATAAACCTCC TTTATATAGA GCATATCAAT GACAAATCAA
AGCTGGAGAT AGGGAGTCTC CATTGATAGA CTTTATTGTT ATCCCCCAAG CATAACTTTA TAAGGAAACA GCTAATTTTC
AAATAATTTA AACCCTCAGC TTAGGCAGCC ATGGAAGCTA GCTGCCTAGC TCAGCATTCT TGCTTGGCCC TCTGCTGTCT
CCTTGCATTG CATCTAGATG ATTGGAAAGC TTCATGGGCA TGGCTACATC TGCTATGAGC CTCAAGGTCT CATGGATTCG
TCCATGAATT TCCCTGCAGC TTTGTGACAA TTATATCAGC TGTATTTCCT TAATGTGATT ACAGCATATA AATATTGATA
AATGTCTACA TTTCCAATTT ATAGCTCACT TGTATTTTGC AGCTTGCACT TCCTAGATAT TAGTCTTCCA AAGGAGATGG
GTGCATAACA TTTGAGTTGA ATTCTGATGT GGACAAGAGT ATTTCATCAT GGACTTTGCG CTAAGGTATC TCACCTTTTC
TTGGAATTAC TATTGCTGCA GAGGATGTAT ATTTAAGTTT CATTGGTCCT TTTTTAAAAA AATGATTTCA AATTTACTAG
AAAGAAACAA GTATATTTTG ACCTGACAGT GACTGCCATT TAAACTTAAC TTCTTTCATT TATAAAGCAT CAGTAAGGTT
CTGCATTAAT TATTTTATGC ATCTTCTTGC CAATCAAGAC AATAGGAGGG GAAGACAAAT TAATCATTTT GCCTCTATAT
TCCATCACAG AATTGCCAAG CCAACATAAC CAAACTGGAG CATCGCATTT AATGATGTTG GTTGGAAAGA CATACCTACT
GAAGGTTTTA ACTTTTAAGC AGTAGTAGAC AGTAGAAATT TGAACAAGGA ACCTCATCAA TGTTCTCCCC AGGTGCATGT
TTCTAGGAAA TTTACTATCA GAAAACAAGA TAAGTAGGTG ACCAACACAT CTGTAAATAG TGGATGAGAC TGTAATTCAT
TGAAAAAGGA GAAAAATACT ACTCAATGAT GTAAATAAAT TAATTGTCAT GTGATGAATC ATATGATTCT ATCCTTTACA
AAAATATATT TGTGCCTCAT GGCACTTCGG CAGTCGGCAG CCTATACATT GAAGTTTATT TAACGAAAAA CGGAAATCTA
ATGTCTTGCT ATTGAGTATT AATTTAGCAA CATAAACTGT ATGGATTTAG GCCATACTCA CGAGAAATAG AGTAATATTT
AGAAGGCCGA AATTTCAAGA TTAGATGACA GCTGAATCTA TACTAAAAGG TTATTAGACA AACTTACAGC ACCACTAAAG
AACCTGTTTA GGTCATGTTA GTTCTAGAAC CCATCCTAGG GTGATACATA ATGGACCTAG AAAATATTCA TAAGCAAAAT
ACAGTACGAA GAATTGTTTT CACTCAATTT CAGAGGTGCA AGCAGGGATC TGGCTGATTC AGGCTTTTTG TTGATTTCTC
TTTTCTTCCT TTTTTTTTCT TTCTTTAAGC TTTTTTCCCC TTAAATTCTT TTGTTACCTT ATCTTGGATA AACATTACTA
CTAATATTAC TATATGAATA AAATTTAGAC ATTTTCCTTA GATTGTAACT GTAAGTTCAT CTGATTATGG GCCGTTTGCA
TCTGCAGAGA GGTTCTCAGA GAAAAAGAAA GACCTCCAGA GAATAATGTG GCTATGCCAA GCCAGTCTAA CCAAAGTGGC
CCTTTTGGGC TATAA

Locus: Os08g0100200

Loading...

Locus: Os08g0100200

Loading...