Os08t0102000-01

Locus

Os08g0102000

Description

Serotonin N-acetyltransferase, Melatonin synthesis

RAP-DB Gene Symbol Synonym(s)

OsSNAT2, SNAT2

RAP-DB Gene Name Synonym(s)

SEROTONIN N-ACETYLTRANSFERASE-2, serotonin N-acetyltransferase-2

CGSNL Gene Symbol

SNAT2

CGSNL Gene Name

SEROTONIN N-ACETYLTRANSFERASE-2

Oryzabase Gene Symbol Synonym(s)

OsSNAT2

Oryzabase Gene Name Synonym(s)

serotonin N-acetyltransferase-2, serotonin N-acetyltransferase 2

Transcript Evidence

AK068156

Protein Evidence

Q6Z1Y6

Literature

PMID: 27121038

Note

Manual Curation

June 9, 2017

Gene Ontology (GO)

Molecular Function: N-acetyltransferase activity (GO:0008080)

Functional domain (InterPro)

Acyl-CoA N-acyltransferase (IPR016181)

GNAT domain (IPR000182)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

chloroplast (GO:0009507)

Full-length cDNA

J013130K21 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0102000-01)

RiceXPro (AK068156)

Others

Oryzabase (21089)

KEGG (Os08t0102000-01 (EC:2.3.1.87))

Transcript

883 bp

>Os08t0102000-01 Serotonin N-acetyltransferase, Melatonin synthesis
GTCATGCAGATGCAGAGGTAGAGGCAGATGCAGATGCAGGCGGCGCGGCCCCGCGTTGGT
GTCCGTCCTCGCGGTGGCATTCGGCCGTTTCCACTGCCCACCTTGAGCTTCAACAACAAC
TCCAACAGGAGTGCGTGTGCGTGTGCGTGTGCGGTGTCGGTGTCGGACTCTGAGCTTGCG
GCGCGCGGGTTCGCGGTGCGGCGCAGCTCGACGGGGCTGGACGTGGGGGCGCTGAACGAG
GTGTTCGCGCGGGTGGGGTTCCCGCGGCGGCAGGAGGAgcggctgcggcgagcgctggag
cacagcgaggtggtgtggctggaggactcggcgtcgtcgtcggcggggcggccggtggcg
ttcgcgcgcgcggcgggggacggcgtgttcaacgcggtggtctgggacgtggtggtggag
ccgtcgtgccagggcctcggcctcggccgcgccgtcatggagcgcctcgtcgccgacctg
cgaggcaagggcgtctccaacatcgcgctctacgccgagccccgcgtcgtgggattctac
cgcctcctcggcttcgccatggaccccgacgccatcaggggcatggcctTCTACCGCTCA
AGGCAACAAATACAAAACACCTCCTCCTAGCTCCTTTTCTATCTTCTTCTTCTCCGATCA
ATATATCCAAAACACATATTGGATTGCATATTAATTTGCATGTGTATGTATGTATATTCA
AGCTGATTATTATTGTCTAGACACACACACACACATGCAGAGTGAAATCAACTCATCAAA
TACATATGTAGTTGCAGCTGATTGCAACCAGTAATCCATTCCATTCATCACACTTGCTAA
TTACACTTCATTCTTGTTTTACCTCTCTCTCTCTCTCTCTCTT

CDS

603 bp

>Os08t0102000-01 Serotonin N-acetyltransferase, Melatonin synthesis
ATGCAGATGCAGGCGGCGCGGCCCCGCGTTGGTGTCCGTCCTCGCGGTGGCATTCGGCCG
TTTCCACTGCCCACCTTGAGCTTCAACAACAACTCCAACAGGAGTGCGTGTGCGTGTGCG
TGTGCGGTGTCGGTGTCGGACTCTGAGCTTGCGGCGCGCGGGTTCGCGGTGCGGCGCAGC
TCGACGGGGCTGGACGTGGGGGCGCTGAACGAGGTGTTCGCGCGGGTGGGGTTCCCGCGG
CGGCAGGAGGAgcggctgcggcgagcgctggagcacagcgaggtggtgtggctggaggac
tcggcgtcgtcgtcggcggggcggccggtggcgttcgcgcgcgcggcgggggacggcgtg
ttcaacgcggtggtctgggacgtggtggtggagccgtcgtgccagggcctcggcctcggc
cgcgccgtcatggagcgcctcgtcgccgacctgcgaggcaagggcgtctccaacatcgcg
ctctacgccgagccccgcgtcgtgggattctaccgcctcctcggcttcgccatggacccc
gacgccatcaggggcatggcctTCTACCGCTCAAGGCAACAAATACAAAACACCTCCTCC
TAG

Protein

201 aa

>Os08t0102000-01 Serotonin N-acetyltransferase, Melatonin synthesis
MQMQAARPRVGVRPRGGIRPFPLPTLSFNNNSNRSACACACAVSVSDSELAARGFAVRRS
STGLDVGALNEVFARVGFPRRQEERLRRALEHSEVVWLEDSASSSAGRPVAFARAAGDGV
FNAVVWDVVVEPSCQGLGLGRAVMERLVADLRGKGVSNIALYAEPRVVGFYRLLGFAMDP
DAIRGMAFYRSRQQIQNTSS*

5'UTR

chr08:110349..110375 (- strand) : 27 bp

CDS

chr08:109746..110348 (- strand) : 603 bp

3'UTR

chr08:109493..109745 (- strand) : 253 bp

FASTA

>Os08t0102000-01 class=Sequence position=chr08:109493..110375 (- strand)
GTCATGCAGA TGCAGAGGTA GAGGCAGATG CAGATGCAGG CGGCGCGGCC CCGCGTTGGT GTCCGTCCTC GCGGTGGCAT
TCGGCCGTTT CCACTGCCCA CCTTGAGCTT CAACAACAAC TCCAACAGGA GTGCGTGTGC GTGTGCGTGT GCGGTGTCGG
TGTCGGACTC TGAGCTTGCG GCGCGCGGGT TCGCGGTGCG GCGCAGCTCG ACGGGGCTGG ACGTGGGGGC GCTGAACGAG
GTGTTCGCGC GGGTGGGGTT CCCGCGGCGG CAGGAGGAgc ggctgcggcg agcgctggag cacagcgagg tggtgtggct
ggaggactcg gcgtcgtcgt cggcggggcg gccggtggcg ttcgcgcgcg cggcggggga cggcgtgttc aacgcggtgg
tctgggacgt ggtggtggag ccgtcgtgcc agggcctcgg cctcggccgc gccgtcatgg agcgcctcgt cgccgacctg
cgaggcaagg gcgtctccaa catcgcgctc tacgccgagc cccgcgtcgt gggattctac cgcctcctcg gcttcgccat
ggaccccgac gccatcaggg gcatggcctT CTACCGCTCA AGGCAACAAA TACAAAACAC CTCCTCCTAG CTCCTTTTCT
ATCTTCTTCT TCTCCGATCA ATATATCCAA AACACATATT GGATTGCATA TTAATTTGCA TGTGTATGTA TGTATATTCA
AGCTGATTAT TATTGTCTAG ACACACACAC ACACATGCAG AGTGAAATCA ACTCATCAAA TACATATGTA GTTGCAGCTG
ATTGCAACCA GTAATCCATT CCATTCATCA CACTTGCTAA TTACACTTCA TTCTTGTTTT ACCTCTCTCT CTCTCTCTCT
CTT

Locus: Os08g0102000

Loading...

Locus: Os08g0102000

Loading...