Os08t0104600-02

Locus

Os08g0104600

Description

Ferredoxin1, Photosynthetic electron transport and carbon assimilation

RAP-DB Gene Symbol Synonym(s)

OsFd1

RAP-DB Gene Name Synonym(s)

ferredoxin 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Fd1, OsFd1, ADI1

Oryzabase Gene Name Synonym(s)

Ferredoxin I, ferredoxin, ferredoxin 1, anti-disease protein 1

Transcript Evidence

AK120393

AK061654

AK119206

AK119709

Protein Evidence

Q0J8M2

Literature

PMID: 32603511

Note

Manual Curation

July 2, 2020

Gene Ontology (GO)

Biological Process: electron transport chain (GO:0022900)

Molecular Function: electron transfer activity (GO:0009055)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Molecular Function: 2 iron, 2 sulfur cluster binding (GO:0051537)

Functional domain (InterPro)

2Fe-2S ferredoxin-like superfamily (IPR036010)

Beta-grasp domain superfamily (IPR012675)

Ferredoxin [2Fe-2S], plant (IPR010241)

2Fe-2S ferredoxin-type iron-sulfur binding domain (IPR001041)

2Fe-2S ferredoxin, iron-sulphur binding site (IPR006058)

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

Full-length cDNA

J013075A06 (Online Clone Ordering)

001-036-C09 (Online Clone Ordering)

001-041-D12 (Online Clone Ordering)

002-157-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0104600-02)

RiceXPro (AK120393)

Others

Oryzabase (9614)

KEGG (Os08t0104600-02)

Transcript

846 bp

>Os08t0104600-02 Ferredoxin1, Photosynthetic electron transport and carbon assimilation
ACATTCTTGCTAGCTCACTCCTCTCCTCCTCGTCTACCTTACCTAGCAGCAGCAGCTAGC
TAGCTTAATTAGCTATAGCAGCCATGGCGGCGACGGCACTGAGCAGCCAGGTCCGGTTGC
CGATGTCCCTGCGGGTGGCGACGGCGCCGGCGCCGGCGCGCGTGTCGGTGCTGCCGGCGA
GCAACAAGCTGGGAGACAGGCTGCGGATGCAGGCGACGTACAACGTGAAGCTGATCACAC
CGGACGGCGAGGTGGAGCTGCAGGTGCCGGACGACGTGTACATCCTGGACCAGGCGGAGG
AGGAAGGGATCGACCTGCCTTACTCCTGCCGCGCGGGCTCCTGCTCCTCCTGCGCCGGCA
AGGTGGTCTCCGGCGAGATCGACCAGTCCGACCAGAGCTTCCTCGACGACGACCAGGTTG
CCGCCGGCTGGGTCCTCACCTGCCACGCCTACCCCAAGTCCGACGTCGTCATCGAGACCC
ACAAGGAGGACGACCTCATCTAATCAATCAAGCAAGCTCCATATTTATAAATCTCTCGAT
CCATCTCCATGCGTTCTTGAGTTTATCAATTAAGAATATAATGTCGTCGTCCCTATGCTA
TGCAAGCAAAGTATTACGTACGTATATGTTGAGCGAGATAACAAAACACAGGCGTGCCCG
AGGGTTAATTGTTGTTGTTTAATTAATGTACGTTTTGCTGCACCTGCTTAATCATATCCA
TATCACATTTTGGTGTCATATATGCATGCATTACTGTGTCATATATACTACTGTCAAATA
CGTACTCCATGTATTTGAAAGAACAGTTAATTAATAAGCTATATATCCTAGTTCTACTCT
TGTGTC

CDS

420 bp

>Os08t0104600-02 Ferredoxin1, Photosynthetic electron transport and carbon assimilation
ATGGCGGCGACGGCACTGAGCAGCCAGGTCCGGTTGCCGATGTCCCTGCGGGTGGCGACG
GCGCCGGCGCCGGCGCGCGTGTCGGTGCTGCCGGCGAGCAACAAGCTGGGAGACAGGCTG
CGGATGCAGGCGACGTACAACGTGAAGCTGATCACACCGGACGGCGAGGTGGAGCTGCAG
GTGCCGGACGACGTGTACATCCTGGACCAGGCGGAGGAGGAAGGGATCGACCTGCCTTAC
TCCTGCCGCGCGGGCTCCTGCTCCTCCTGCGCCGGCAAGGTGGTCTCCGGCGAGATCGAC
CAGTCCGACCAGAGCTTCCTCGACGACGACCAGGTTGCCGCCGGCTGGGTCCTCACCTGC
CACGCCTACCCCAAGTCCGACGTCGTCATCGAGACCCACAAGGAGGACGACCTCATCTAA

Protein

140 aa

>Os08t0104600-02 Ferredoxin1, Photosynthetic electron transport and carbon assimilation
MAATALSSQVRLPMSLRVATAPAPARVSVLPASNKLGDRLRMQATYNVKLITPDGEVELQ
VPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKVVSGEIDQSDQSFLDDDQVAAGWVLTC
HAYPKSDVVIETHKEDDLI*

5'UTR

chr08:242546..242628 (- strand) : 83 bp

CDS

chr08:242126..242545 (- strand) : 420 bp

3'UTR

chr08:241783..242125 (- strand) : 343 bp

FASTA

>Os08t0104600-02 class=Sequence position=chr08:241783..242628 (- strand)
ACATTCTTGC TAGCTCACTC CTCTCCTCCT CGTCTACCTT ACCTAGCAGC AGCAGCTAGC TAGCTTAATT AGCTATAGCA
GCCATGGCGG CGACGGCACT GAGCAGCCAG GTCCGGTTGC CGATGTCCCT GCGGGTGGCG ACGGCGCCGG CGCCGGCGCG
CGTGTCGGTG CTGCCGGCGA GCAACAAGCT GGGAGACAGG CTGCGGATGC AGGCGACGTA CAACGTGAAG CTGATCACAC
CGGACGGCGA GGTGGAGCTG CAGGTGCCGG ACGACGTGTA CATCCTGGAC CAGGCGGAGG AGGAAGGGAT CGACCTGCCT
TACTCCTGCC GCGCGGGCTC CTGCTCCTCC TGCGCCGGCA AGGTGGTCTC CGGCGAGATC GACCAGTCCG ACCAGAGCTT
CCTCGACGAC GACCAGGTTG CCGCCGGCTG GGTCCTCACC TGCCACGCCT ACCCCAAGTC CGACGTCGTC ATCGAGACCC
ACAAGGAGGA CGACCTCATC TAATCAATCA AGCAAGCTCC ATATTTATAA ATCTCTCGAT CCATCTCCAT GCGTTCTTGA
GTTTATCAAT TAAGAATATA ATGTCGTCGT CCCTATGCTA TGCAAGCAAA GTATTACGTA CGTATATGTT GAGCGAGATA
ACAAAACACA GGCGTGCCCG AGGGTTAATT GTTGTTGTTT AATTAATGTA CGTTTTGCTG CACCTGCTTA ATCATATCCA
TATCACATTT TGGTGTCATA TATGCATGCA TTACTGTGTC ATATATACTA CTGTCAAATA CGTACTCCAT GTATTTGAAA
GAACAGTTAA TTAATAAGCT ATATATCCTA GTTCTACTCT TGTGTC

Locus: Os08g0104600

Loading...

Locus: Os08g0104600

Loading...