Os08t0104900-01

Locus

Os08g0104900

Description

Protein of unknown function DUF6, transmembrane domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK101575 (DDBJ, Best hit)

Protein Evidence

B4G1R1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Drug/metabolite transporter (IPR000620)

Domain of unknown function DUF250 (IPR004853)

Full-length cDNA

J033050J21 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0104900-01)

RiceXPro (AK101575)

Others

KEGG (Os08t0104900-01)

Transcript

1694 bp

>Os08t0104900-01 Protein of unknown function DUF6, transmembrane domain containing protein.
ACGTACTATGCTAGACTAGACAACACCCAAAGGCAAAGAGAGGGAGGGAATCATCTGCTC
ACACCAACCGAACTCGCAACCTAAACACCTCCCTCTTCGATTCACTTCATCTTCCTCTTC
TCTTCTCGTCTCTTGTAGTAGTATATATTTATAAAGCCCCCAAACAAAAGAGAAGACAAC
TGAATTAGTTCGATCGATGCAGGCAGGCAGGCCTTCTAGTTCTACAAAGATGCCTCTAAT
GGATCGTTTTCCTTTCCTATCGATGGCTTGATTGATACAAAGCCGGTTTTTTCACTCCTC
GGGCGTGCGTTTCTTGACACCGGCCGGATTGATCTATCATCCATCCATCGAGTCGAGTCG
AGATCGATCTTGATCTCGATCTCGATCGATGGAGGAAGCCAAGATGGGAGACGTTGCCAC
CATCCGAGCCGTTCTGGCGATCCTCCAATGGTGGGGCTTCAACGTCACCGTCATCATCAT
GAACAAATGGATCTTCCAGAAATTGGAGTTCAAGTTCCCTCTTACTGTCTCGTGTGTCCA
CTTTATATGCTCTTCGATTGGAGCTTACATCGCAATCAAAATTCTCAAGATGAAACCACT
GATTGAAGTTGCCCCAGAGGATCGGTGGAGAAGAATATTCCCAATGTCATTTGTGTTCTG
CATAAACATTGTACTGGGAAATGTCAGCCTGAGATATATTCCAGTCTCCTTCATGCAGAC
CATAAAATCTTTCACCCCTGCAACGACAGTTATTCTGCAGTGGTTGGTCTGGAGGAAGTA
TTTCGAGTGGCGCATATGGGCTTCTCTGGTACCAATAGTGGGAGGAATCATGTTAACATC
AATAACTGAGCTTAGTTTCAACATGTTTGGTTTTTGTGCTGCTATGGTTGGTTGCCTGGC
AACATCTACCAAGACCATCCTTGCAGAGTCTCTACTCCATGGATACAAATTTGATAGCAT
TAACACTGTGTACTACATGGCGCCATTTGCAACCATGATACTGTCAGTACCAGCGATTGT
GCTGGAAGGGAGTGGCGTCATCAATTGGCTCTACACGTATGATTCCATCGTCCCTGCACT
GATCATCATCACCACCTCCGGAGTACTCGCATTTTGCCTCAACTTCTCCATCTTCTACGT
CATCCATTCCACAACGGCTGTCACCTTTAACGTAGCCGGCAACCTGAAAGTTGCTGTGGC
TGTGTTGGTGTCGTGGATGATCTTCCGGAACCCGATCTCCGCGATGAACGCTGTCGGGTG
CGCAATCACGCTCGTCGGCTGCACCTTCTATGGCTATGTGAGGCATCTCATCTCGCAGCA
GAGCGTTAATTCGAGCCCACGCACGCCGAGGAGCCGGATGGAGATGCTTCCCCTCGTAGG
AGACAAGCAAGAGAAGATTTAATTGGCCACCAAATTAAAACAAGTTGATACTCAAAAGAG
GAGGGAATTGTTGGTGCATGATCAATAGGAATAAAGGAGCATCATCTAACAGCTTTCAGG
ATTAATCCTGAGGCACTTTTGTCATAGAAAATTATTCAGAGTTTTCAGTTGAGTTGTTCG
TATAGAGCTAATAGAACTTCCTTCTTGTCATCTGAACATGCTGGGGTGCTCCTCAGCTGT
ATCTCTCTCTCTCTCTCTCTTTCTATTCTTTTCTTCCTTTTTCTCACAGGATTAAAAGAT
TTTTGTTTGCTCGT

CDS

1014 bp

>Os08t0104900-01 Protein of unknown function DUF6, transmembrane domain containing protein.
ATGGAGGAAGCCAAGATGGGAGACGTTGCCACCATCCGAGCCGTTCTGGCGATCCTCCAA
TGGTGGGGCTTCAACGTCACCGTCATCATCATGAACAAATGGATCTTCCAGAAATTGGAG
TTCAAGTTCCCTCTTACTGTCTCGTGTGTCCACTTTATATGCTCTTCGATTGGAGCTTAC
ATCGCAATCAAAATTCTCAAGATGAAACCACTGATTGAAGTTGCCCCAGAGGATCGGTGG
AGAAGAATATTCCCAATGTCATTTGTGTTCTGCATAAACATTGTACTGGGAAATGTCAGC
CTGAGATATATTCCAGTCTCCTTCATGCAGACCATAAAATCTTTCACCCCTGCAACGACA
GTTATTCTGCAGTGGTTGGTCTGGAGGAAGTATTTCGAGTGGCGCATATGGGCTTCTCTG
GTACCAATAGTGGGAGGAATCATGTTAACATCAATAACTGAGCTTAGTTTCAACATGTTT
GGTTTTTGTGCTGCTATGGTTGGTTGCCTGGCAACATCTACCAAGACCATCCTTGCAGAG
TCTCTACTCCATGGATACAAATTTGATAGCATTAACACTGTGTACTACATGGCGCCATTT
GCAACCATGATACTGTCAGTACCAGCGATTGTGCTGGAAGGGAGTGGCGTCATCAATTGG
CTCTACACGTATGATTCCATCGTCCCTGCACTGATCATCATCACCACCTCCGGAGTACTC
GCATTTTGCCTCAACTTCTCCATCTTCTACGTCATCCATTCCACAACGGCTGTCACCTTT
AACGTAGCCGGCAACCTGAAAGTTGCTGTGGCTGTGTTGGTGTCGTGGATGATCTTCCGG
AACCCGATCTCCGCGATGAACGCTGTCGGGTGCGCAATCACGCTCGTCGGCTGCACCTTC
TATGGCTATGTGAGGCATCTCATCTCGCAGCAGAGCGTTAATTCGAGCCCACGCACGCCG
AGGAGCCGGATGGAGATGCTTCCCCTCGTAGGAGACAAGCAAGAGAAGATTTAA

Protein

338 aa

>Os08t0104900-01 Protein of unknown function DUF6, transmembrane domain containing protein.
MEEAKMGDVATIRAVLAILQWWGFNVTVIIMNKWIFQKLEFKFPLTVSCVHFICSSIGAY
IAIKILKMKPLIEVAPEDRWRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATT
VILQWLVWRKYFEWRIWASLVPIVGGIMLTSITELSFNMFGFCAAMVGCLATSTKTILAE
SLLHGYKFDSINTVYYMAPFATMILSVPAIVLEGSGVINWLYTYDSIVPALIIITTSGVL
AFCLNFSIFYVIHSTTAVTFNVAGNLKVAVAVLVSWMIFRNPISAMNAVGCAITLVGCTF
YGYVRHLISQQSVNSSPRTPRSRMEMLPLVGDKQEKI*

5'UTR

chr08:271690..272077 (- strand) : 388 bp

CDS

chr08:271579..271689 (- strand) : 111 bp

chr08:270109..270358 (- strand) : 250 bp

chr08:269767..269974 (- strand) : 208 bp

chr08:269393..269624 (- strand) : 232 bp

chr08:269097..269309 (- strand) : 213 bp

3'UTR

chr08:268805..269096 (- strand) : 292 bp

FASTA

>Os08t0104900-01 class=Sequence position=chr08:268805..272077 (- strand)
ACGTACTATG CTAGACTAGA CAACACCCAA AGGCAAAGAG AGGGAGGGAA TCATCTGCTC ACACCAACCG AACTCGCAAC
CTAAACACCT CCCTCTTCGA TTCACTTCAT CTTCCTCTTC TCTTCTCGTC TCTTGTAGTA GTATATATTT ATAAAGCCCC
CAAACAAAAG AGAAGACAAC TGAATTAGTT CGATCGATGC AGGCAGGCAG GCCTTCTAGT TCTACAAAGA TGCCTCTAAT
GGATCGTTTT CCTTTCCTAT CGATGGCTTG ATTGATACAA AGCCGGTTTT TTCACTCCTC GGGCGTGCGT TTCTTGACAC
CGGCCGGATT GATCTATCAT CCATCCATCG AGTCGAGTCG AGATCGATCT TGATCTCGAT CTCGATCGAT GGAGGAAGCC
AAGATGGGAG ACGTTGCCAC CATCCGAGCC GTTCTGGCGA TCCTCCAATG GTGGGGCTTC AACGTCACCG TCATCATCAT
GAACAAATGG ATCTTCCAGG TTCCAATTCT TCCATAATCT TCCTCTCCTT TTCTTCCCCC CCCCCCCCCC CTATTCTTCT
TCCGTTACTT CCTTTTTCTT TTCTGTCCTT GAGATGATCC CCTCGTATGA TTATTAACAG CAAAGGGTCA CGCACGCCTT
TCCTGCAAAT TATCTGCTTC ACATGGGTGT AGTTGATTTC CTAGGGATGC AGCATAATAT AGGAACATGA AACAAGATAC
TCCATCAAAG GAACAATCTT TTTGTGCGTA TAGTTTGCTT CATCTGGTAG TTTATGGGTG GCTATGACTG GGAAAAGGGA
ATCATCTTTT GAGAATTGAG ATTTACAAAA CTCCAAGGAC TCTGTTCCTT TCAGACACTG AAAGGAATTG TCAATTTGTC
ATGTCCTCTT AAGAATGAGT TAAATGTTCA GAAAAGATAA CGAGAAATAC AACGGAGAGA TCGAGGATAT GACTCAAAAC
ACTACCTTTT CTAGCTGGCA ATCATTCTAA CTGAAAATGT TTCCTCAAAA GATTATAAAG TTTGACAATT CTCTTTTGGT
GGATCACCCA CGCAGCCACA CCCAAGTGTA AGTCAACTCT ATGGTTCTAC CTTAAATTTG AAGTACAACG TCGCATCCAA
AAAGAAAAAA AAAAGCTTAA AGTTTGCATC TTGATGCCCT TGATGGATGT CCAATGTAAA GTTAACTAGA ACAGTGCTGA
TTCTGGAAGG AACTTTGGTG GAGTAGCTTT CATGAATATT GAACCCTTGG AAGGGATCTC TCCACCTGTT TTTGGGTTCA
AAAAGGAAAA AAAAATCACC TCCTTGCAAC CATCTATATT TTTGAAGGTT GTGGTACAAT TCTTTTTATC GGAACACACA
AAGAGCTTGC GTATCATTGC ATTAAGAAAA CTTGGTTTTA AAGATACTAA CAGCCTGCAT ACCACAGGAT ATTAGACTCA
GTGCAAAAAC AAAACTGCTG CTATTCTGAA GCAACTTCGT GGTCTTTGTA ACCTTTGTCA CTTAAAGTGG CCTGGGTGAT
GTATTACTGA AGAAACCCTG TAGCGTGTGA TGTTTTCTCG CTGCACAAAT CGATCCTTGA TGATGAAGTG TACAGTTCCT
CTTTTTTCTT CGAATTGACT TGGGAGTCCA AAATTGTGTT CTTTTTCAGA ATATTACTGC ATAATCATTC ACACAAGTCA
TCAATTTGAT GGTTTTCATT TTTTTTTCCT TGGATGCAGA AATTGGAGTT CAAGTTCCCT CTTACTGTCT CGTGTGTCCA
CTTTATATGC TCTTCGATTG GAGCTTACAT CGCAATCAAA ATTCTCAAGA TGAAACCACT GATTGAAGTT GCCCCAGAGG
ATCGGTGGAG AAGAATATTC CCAATGTCAT TTGTGTTCTG CATAAACATT GTACTGGGAA ATGTCAGCCT GAGATATATT
CCAGTCTCCT TCATGCAGAC CATAAAATCT TTCACCCCTG CAACGACAGG TTCTCTGATT CCTGGCCTTT CTAAGCTCTT
TTTTTTTTTG AGCTCTTTAT TGTCAATTCA GTCGTTCTCA GTTATTCCGC TTTTCTGCAA TTAATGTAAG CATATTCTGA
TGGATTCTTC CATTGTAACA CAGTTATTCT GCAGTGGTTG GTCTGGAGGA AGTATTTCGA GTGGCGCATA TGGGCTTCTC
TGGTACCAAT AGTGGGAGGA ATCATGTTAA CATCAATAAC TGAGCTTAGT TTCAACATGT TTGGTTTTTG TGCTGCTATG
GTTGGTTGCC TGGCAACATC TACCAAGACC ATCCTTGCAG AGTCTCTACT CCATGGATAC AAATTTGATA GGTAAAAATG
GATTCTTTTT ACCTTGGGCC AGTAAAAATT GATTCAGTCT GAATTTTACT TTACCATACT TAGCCTTGCA TGTTTTCCTC
TTTTGGTGTG TTTATTGATT CTGCATCTGT CATTTTGTTC TTCTTCTGTG CAGCATTAAC ACTGTGTACT ACATGGCGCC
ATTTGCAACC ATGATACTGT CAGTACCAGC GATTGTGCTG GAAGGGAGTG GCGTCATCAA TTGGCTCTAC ACGTATGATT
CCATCGTCCC TGCACTGATC ATCATCACCA CCTCCGGAGT ACTCGCATTT TGCCTCAACT TCTCCATCTT CTACGTCATC
CATTCCACAA CGGCTGTCAC CTTTAACGTA GCCGGCAACC TGAAAGTGAG ACTCGACTGC AACTCTACTG CTGTTCATTT
GTGCTCTGCA TTCACAAATT GGGTTGATGG ATACTGTGAT TTATACAGGT TGCTGTGGCT GTGTTGGTGT CGTGGATGAT
CTTCCGGAAC CCGATCTCCG CGATGAACGC TGTCGGGTGC GCAATCACGC TCGTCGGCTG CACCTTCTAT GGCTATGTGA
GGCATCTCAT CTCGCAGCAG AGCGTTAATT CGAGCCCACG CACGCCGAGG AGCCGGATGG AGATGCTTCC CCTCGTAGGA
GACAAGCAAG AGAAGATTTA ATTGGCCACC AAATTAAAAC AAGTTGATAC TCAAAAGAGG AGGGAATTGT TGGTGCATGA
TCAATAGGAA TAAAGGAGCA TCATCTAACA GCTTTCAGGA TTAATCCTGA GGCACTTTTG TCATAGAAAA TTATTCAGAG
TTTTCAGTTG AGTTGTTCGT ATAGAGCTAA TAGAACTTCC TTCTTGTCAT CTGAACATGC TGGGGTGCTC CTCAGCTGTA
TCTCTCTCTC TCTCTCTCTT TCTATTCTTT TCTTCCTTTT TCTCACAGGA TTAAAAGATT TTTGTTTGCT CGT

Locus: Os08g0104900

Loading...

Locus: Os08g0104900

Loading...