Os08t0104900-02

Locus

Os08g0104900

Description

Protein of unknown function DUF6, transmembrane domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK063987 (DDBJ, Best hit)

Protein Evidence

B4G1R1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Drug/metabolite transporter (IPR000620)

Domain of unknown function DUF250 (IPR004853)

Full-length cDNA

001-124-D11 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0104900-02)

RiceXPro (AK063987)

Others

KEGG (Os08t0104900-02)

Transcript

1589 bp

>Os08t0104900-02 Protein of unknown function DUF6, transmembrane domain containing protein.
AACTGAATTAGTTCGATCGATGCAGGCAGGCAGGCCTTCTAGTTCTACAAAGATGCCTCT
AATGGATCGTTTTCCTTTCCTATCGATGGCTTGATTGATACAAAGCCGGTTTTTTCACTC
CTCGGGCGTGCGTTTCTTGACACCGGCCGGATTGATCTATCATCCATCCATCGAGTCGAG
TCGAGATCGATCTTGATCTCGATCTCGATCGATGGAGGAAGCCAAGATGGGAGACGTTGC
CACCATCCGAGCCGTTCTGGCGATCCTCCAATGGTGGGGCTTCAACGTCACCGTCATCAT
CATGAACAAATGGATCTTCCAGAAATTGGAGTTCAAGTTCCCTCTTACTGTCTCGTGTGT
CCACTTTATATGCTCTTCGATTGGAGCTTACATCGCAATCAAAATTCTCAAGATGAAACC
ACTGATTGAAGTTGCCCCAGAGGATCGGTGGAGAAGAATATTCCCAATGTCATTTGTGTT
CTGCATAAACATTGTACTGGGAAATGTCAGCCTGAGATATATTCCAGTCTCCTTCATGCA
GACCATAAAATCTTTCACCCCTGCAACGACAGTTATTCTGCAGTGGTTGGTCTGGAGGAA
GTATTTCGAGTGGCGCATATGGGCTTCTCTGGTACCAATAGTGGGAGGAATCATGTTAAC
ATCAATAACTGAGCTTAGTTTCAACATGTTTGGTTTTTGTGCTGCTATGGTTGGTTGCCT
GGCAACATCTACCAAGACCATCCTTGCAGAGTCTCTACTCCATGGATACAAATTTGATAG
CATTAACACTGTGTACTACATGGCGCCATTTGCAACCATGATACTGTCAGTACCAGCGAT
TGTGCTGGAAGGGAGTGGCGTCATCAATTGGCTCTACACGTATGATTCCATCGTCCCTGC
ACTGATCATCATCACCACCTCCGGAGTACTCGCATTTTGCCTCAACTTCTCCATCTTCTA
CGTCATCCATTCCACAACGGCTGTCACCTTTAACGTAGCCGGCAACCTGAAAGTTGCTGT
GGCTGTGTTGGTGTCGTGGATGATCTTCCGGAACCCGATCTCCGCGATGAACGCTGTCGG
GTGCGCAATCACGCTCGTCGGCTGCACCTTCTATGGCTATGTGAGGCATCTCATCTCGCA
GCAGAGCGTTAATTCGAGCCCACGCACGCCGAGGAGCCGGATGGAGATGCTTCCCCTCGT
AGGAGACAAGCAAGAGAAGATTTAATTGGCCACCAAATTAAAACAAGTTGATACTCAAAA
GAGGAGGGAATTGTTGGTGCATGATCAATAGGAATAAAGGAGCATCATCTAACAGCTTTC
AGGATTAATCCTGAGGCACTTTTGTCATAGAAAATTATTCAGAGTTTTCAGTTGAGTTGT
TCGTATAGAGCTAATAGAACTTCCTTCTTGTCATCTGAACATGCTGGGGTGCTCCTCAGC
TGTATCTCTCTCTCTCTCTCTCTTTCTATTCTTTTCTTCCTTTTTCTCACAGGATTAAAA
GATTTTTGTTTGCTCGTAACTATGCTACTATTGCTACACATTTGATCACACAGCATTGTT
CAGTTGACTATAGATATTATTATTATGTT

CDS

1014 bp

>Os08t0104900-02 Protein of unknown function DUF6, transmembrane domain containing protein.
ATGGAGGAAGCCAAGATGGGAGACGTTGCCACCATCCGAGCCGTTCTGGCGATCCTCCAA
TGGTGGGGCTTCAACGTCACCGTCATCATCATGAACAAATGGATCTTCCAGAAATTGGAG
TTCAAGTTCCCTCTTACTGTCTCGTGTGTCCACTTTATATGCTCTTCGATTGGAGCTTAC
ATCGCAATCAAAATTCTCAAGATGAAACCACTGATTGAAGTTGCCCCAGAGGATCGGTGG
AGAAGAATATTCCCAATGTCATTTGTGTTCTGCATAAACATTGTACTGGGAAATGTCAGC
CTGAGATATATTCCAGTCTCCTTCATGCAGACCATAAAATCTTTCACCCCTGCAACGACA
GTTATTCTGCAGTGGTTGGTCTGGAGGAAGTATTTCGAGTGGCGCATATGGGCTTCTCTG
GTACCAATAGTGGGAGGAATCATGTTAACATCAATAACTGAGCTTAGTTTCAACATGTTT
GGTTTTTGTGCTGCTATGGTTGGTTGCCTGGCAACATCTACCAAGACCATCCTTGCAGAG
TCTCTACTCCATGGATACAAATTTGATAGCATTAACACTGTGTACTACATGGCGCCATTT
GCAACCATGATACTGTCAGTACCAGCGATTGTGCTGGAAGGGAGTGGCGTCATCAATTGG
CTCTACACGTATGATTCCATCGTCCCTGCACTGATCATCATCACCACCTCCGGAGTACTC
GCATTTTGCCTCAACTTCTCCATCTTCTACGTCATCCATTCCACAACGGCTGTCACCTTT
AACGTAGCCGGCAACCTGAAAGTTGCTGTGGCTGTGTTGGTGTCGTGGATGATCTTCCGG
AACCCGATCTCCGCGATGAACGCTGTCGGGTGCGCAATCACGCTCGTCGGCTGCACCTTC
TATGGCTATGTGAGGCATCTCATCTCGCAGCAGAGCGTTAATTCGAGCCCACGCACGCCG
AGGAGCCGGATGGAGATGCTTCCCCTCGTAGGAGACAAGCAAGAGAAGATTTAA

Protein

338 aa

>Os08t0104900-02 Protein of unknown function DUF6, transmembrane domain containing protein.
MEEAKMGDVATIRAVLAILQWWGFNVTVIIMNKWIFQKLEFKFPLTVSCVHFICSSIGAY
IAIKILKMKPLIEVAPEDRWRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATT
VILQWLVWRKYFEWRIWASLVPIVGGIMLTSITELSFNMFGFCAAMVGCLATSTKTILAE
SLLHGYKFDSINTVYYMAPFATMILSVPAIVLEGSGVINWLYTYDSIVPALIIITTSGVL
AFCLNFSIFYVIHSTTAVTFNVAGNLKVAVAVLVSWMIFRNPISAMNAVGCAITLVGCTF
YGYVRHLISQQSVNSSPRTPRSRMEMLPLVGDKQEKI*

5'UTR

chr08:271690..271900 (- strand) : 211 bp

CDS

chr08:271579..271689 (- strand) : 111 bp

chr08:270109..270358 (- strand) : 250 bp

chr08:269767..269974 (- strand) : 208 bp

chr08:269393..269624 (- strand) : 232 bp

chr08:269097..269309 (- strand) : 213 bp

3'UTR

chr08:268733..269096 (- strand) : 364 bp

FASTA

>Os08t0104900-02 class=Sequence position=chr08:268733..271900 (- strand)
AACTGAATTA GTTCGATCGA TGCAGGCAGG CAGGCCTTCT AGTTCTACAA AGATGCCTCT AATGGATCGT TTTCCTTTCC
TATCGATGGC TTGATTGATA CAAAGCCGGT TTTTTCACTC CTCGGGCGTG CGTTTCTTGA CACCGGCCGG ATTGATCTAT
CATCCATCCA TCGAGTCGAG TCGAGATCGA TCTTGATCTC GATCTCGATC GATGGAGGAA GCCAAGATGG GAGACGTTGC
CACCATCCGA GCCGTTCTGG CGATCCTCCA ATGGTGGGGC TTCAACGTCA CCGTCATCAT CATGAACAAA TGGATCTTCC
AGGTTCCAAT TCTTCCATAA TCTTCCTCTC CTTTTCTTCC CCCCCCCCCC CCCCTATTCT TCTTCCGTTA CTTCCTTTTT
CTTTTCTGTC CTTGAGATGA TCCCCTCGTA TGATTATTAA CAGCAAAGGG TCACGCACGC CTTTCCTGCA AATTATCTGC
TTCACATGGG TGTAGTTGAT TTCCTAGGGA TGCAGCATAA TATAGGAACA TGAAACAAGA TACTCCATCA AAGGAACAAT
CTTTTTGTGC GTATAGTTTG CTTCATCTGG TAGTTTATGG GTGGCTATGA CTGGGAAAAG GGAATCATCT TTTGAGAATT
GAGATTTACA AAACTCCAAG GACTCTGTTC CTTTCAGACA CTGAAAGGAA TTGTCAATTT GTCATGTCCT CTTAAGAATG
AGTTAAATGT TCAGAAAAGA TAACGAGAAA TACAACGGAG AGATCGAGGA TATGACTCAA AACACTACCT TTTCTAGCTG
GCAATCATTC TAACTGAAAA TGTTTCCTCA AAAGATTATA AAGTTTGACA ATTCTCTTTT GGTGGATCAC CCACGCAGCC
ACACCCAAGT GTAAGTCAAC TCTATGGTTC TACCTTAAAT TTGAAGTACA ACGTCGCATC CAAAAAGAAA AAAAAAAGCT
TAAAGTTTGC ATCTTGATGC CCTTGATGGA TGTCCAATGT AAAGTTAACT AGAACAGTGC TGATTCTGGA AGGAACTTTG
GTGGAGTAGC TTTCATGAAT ATTGAACCCT TGGAAGGGAT CTCTCCACCT GTTTTTGGGT TCAAAAAGGA AAAAAAAATC
ACCTCCTTGC AACCATCTAT ATTTTTGAAG GTTGTGGTAC AATTCTTTTT ATCGGAACAC ACAAAGAGCT TGCGTATCAT
TGCATTAAGA AAACTTGGTT TTAAAGATAC TAACAGCCTG CATACCACAG GATATTAGAC TCAGTGCAAA AACAAAACTG
CTGCTATTCT GAAGCAACTT CGTGGTCTTT GTAACCTTTG TCACTTAAAG TGGCCTGGGT GATGTATTAC TGAAGAAACC
CTGTAGCGTG TGATGTTTTC TCGCTGCACA AATCGATCCT TGATGATGAA GTGTACAGTT CCTCTTTTTT CTTCGAATTG
ACTTGGGAGT CCAAAATTGT GTTCTTTTTC AGAATATTAC TGCATAATCA TTCACACAAG TCATCAATTT GATGGTTTTC
ATTTTTTTTT CCTTGGATGC AGAAATTGGA GTTCAAGTTC CCTCTTACTG TCTCGTGTGT CCACTTTATA TGCTCTTCGA
TTGGAGCTTA CATCGCAATC AAAATTCTCA AGATGAAACC ACTGATTGAA GTTGCCCCAG AGGATCGGTG GAGAAGAATA
TTCCCAATGT CATTTGTGTT CTGCATAAAC ATTGTACTGG GAAATGTCAG CCTGAGATAT ATTCCAGTCT CCTTCATGCA
GACCATAAAA TCTTTCACCC CTGCAACGAC AGGTTCTCTG ATTCCTGGCC TTTCTAAGCT CTTTTTTTTT TTGAGCTCTT
TATTGTCAAT TCAGTCGTTC TCAGTTATTC CGCTTTTCTG CAATTAATGT AAGCATATTC TGATGGATTC TTCCATTGTA
ACACAGTTAT TCTGCAGTGG TTGGTCTGGA GGAAGTATTT CGAGTGGCGC ATATGGGCTT CTCTGGTACC AATAGTGGGA
GGAATCATGT TAACATCAAT AACTGAGCTT AGTTTCAACA TGTTTGGTTT TTGTGCTGCT ATGGTTGGTT GCCTGGCAAC
ATCTACCAAG ACCATCCTTG CAGAGTCTCT ACTCCATGGA TACAAATTTG ATAGGTAAAA ATGGATTCTT TTTACCTTGG
GCCAGTAAAA ATTGATTCAG TCTGAATTTT ACTTTACCAT ACTTAGCCTT GCATGTTTTC CTCTTTTGGT GTGTTTATTG
ATTCTGCATC TGTCATTTTG TTCTTCTTCT GTGCAGCATT AACACTGTGT ACTACATGGC GCCATTTGCA ACCATGATAC
TGTCAGTACC AGCGATTGTG CTGGAAGGGA GTGGCGTCAT CAATTGGCTC TACACGTATG ATTCCATCGT CCCTGCACTG
ATCATCATCA CCACCTCCGG AGTACTCGCA TTTTGCCTCA ACTTCTCCAT CTTCTACGTC ATCCATTCCA CAACGGCTGT
CACCTTTAAC GTAGCCGGCA ACCTGAAAGT GAGACTCGAC TGCAACTCTA CTGCTGTTCA TTTGTGCTCT GCATTCACAA
ATTGGGTTGA TGGATACTGT GATTTATACA GGTTGCTGTG GCTGTGTTGG TGTCGTGGAT GATCTTCCGG AACCCGATCT
CCGCGATGAA CGCTGTCGGG TGCGCAATCA CGCTCGTCGG CTGCACCTTC TATGGCTATG TGAGGCATCT CATCTCGCAG
CAGAGCGTTA ATTCGAGCCC ACGCACGCCG AGGAGCCGGA TGGAGATGCT TCCCCTCGTA GGAGACAAGC AAGAGAAGAT
TTAATTGGCC ACCAAATTAA AACAAGTTGA TACTCAAAAG AGGAGGGAAT TGTTGGTGCA TGATCAATAG GAATAAAGGA
GCATCATCTA ACAGCTTTCA GGATTAATCC TGAGGCACTT TTGTCATAGA AAATTATTCA GAGTTTTCAG TTGAGTTGTT
CGTATAGAGC TAATAGAACT TCCTTCTTGT CATCTGAACA TGCTGGGGTG CTCCTCAGCT GTATCTCTCT CTCTCTCTCT
CTTTCTATTC TTTTCTTCCT TTTTCTCACA GGATTAAAAG ATTTTTGTTT GCTCGTAACT ATGCTACTAT TGCTACACAT
TTGATCACAC AGCATTGTTC AGTTGACTAT AGATATTATT ATTATGTT

Locus: Os08g0104900

Loading...

Locus: Os08g0104900

Loading...