Os08t0105000-01

Locus

Os08g0105000

Description

Homeodomain (PHD) transcriptional regulator, Flowering promoter

RAP-DB Gene Symbol Synonym(s)

EHD3

RAP-DB Gene Name Synonym(s)

EARLY HEADING DATE 3, Early heading date3, PHD transcription factor

CGSNL Gene Symbol

EHD3

CGSNL Gene Name

EARLY HEADING DATE 3

Oryzabase Gene Symbol Synonym(s)

Ehd3, OsPHD36, PHD36

Oryzabase Gene Name Synonym(s)

Early heading date3, PHD transcription factor, Plant homeo-domain finger protein 36, PHD finger protein 36

Transcript Evidence

AB517626 (Tohoku IL9, functional allele)

AB517627 (Tohoku IL9, non-functional allele)

AK069782

Protein Evidence

Q6ZJM9

Literature

PMID: 21284756

Note

Manual Curation

May 24, 2011

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, PHD-type (IPR001965)

Zinc finger, PHD-finger (IPR019787)

Full-length cDNA

J023030H04 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0105000-01)

RiceXPro (AK069782)

Others

Oryzabase (9301)

KEGG (Os08t0105000-01)

Transcript

2708 bp

>Os08t0105000-01 Homeodomain (PHD) transcriptional regulator, Flowering promoter
AGTTTCCATTCCCGTTCCGTTATAATAAGAGGAGAGAGAGAGAGATTTTGGGTTTGTCTC
CGGCTCCGCTCGCCGCCTCCAAATCCCGCTCCTCCGCTGCTGCTCCTCTCTGCCGCGGCG
AGGCGAGAGATCCGAATCCACCGCCACCCGCGCCCACCCCGCCCGCACAAACCCTAGTTT
TTCCGGGGTTTTGCTTCCCCTCCGCAGCTCCGCTCCGCTCCGTCCGTCGTCTCCTCCCGG
CGGCTCGGCTTGCTGTCCATGCTGTAGCCGCCCCCCGCAGGTGGCTGATGGGCTCCCAGA
ACCGCCCCCCACCACCGCGCAAGAGGCAGCCGCCGCCGCCGGAGGACCACCTCGTCACCT
ACAAGCGCCGCCGCTCCAAAGAAACACAGCCTTTGCCACTCATGGCCAACGGCGCCAATT
CTAAGAAAGACGCCAAGGCCCAACATTGGATTAGCTGGAGGGACACTCTCCACGGCTTCC
TCCAATCCCCTGCTATTAGCCAGGGTGGAGGAATTCAGACCTGCATCCGTCATGCTCTCC
AACACAATCCTTGCTTGCTCACCAATGGTGTTGTTGTTCACACTGAATTCAAAGGTAACC
CAGCTCATTCCCAAGGAGAGGAAGCAAAAGTGCAGCACCCTAATGGTGCTGCTGGAGGCA
AGGTGGTTTCTGCAGATGCTGCTATACAAGATGCGGCTGCCGCAGCTTCTTCCGAAGCTA
ACAAGGCAATGTGTAATAATGCCCTCTTCGACATTTTGGTCTCCCAGAAATTTGCCTTGT
TGTGCCATTTGCTACTTGGGACCTTCCATGTCAATAAACCTGGTGATGTCATCGACTTGG
AAAAAATCGACGCCAAGATGAGAAATGGAGACTATGCCCACAACCCTGCACTATTTGACG
ATGATATCCAGCAGATGTGGGAGAAGTTTGAGCAAGTTGGCCAAGAGATGACAGGTCTAG
CGAGCAACCTTTCAACCATTTCACGAGTTTCATACCAAAAGCAGGCTTCTGGATTTTCTG
AAGCTGAGGTGGCTGAGCACAGAATAGAGGAAATAAGTTTGCCGGGTGCTGTCCACGTTG
TCACAAAGGAGTCGACTACCACCGTGCAGTTGGCCCCATGTGATTCTAGTCATTCTACAA
TACCGAAACGAACTGTGCCACCTGGACGTGATCTGTGCCCTTGCGATGGTTGTGGCACCA
AGGTAGATGTTGAAGAAGGCCTAATCTGTGATGAATGTGACACCATGTACCACTTTGCAT
GTGTCAAGCTACTCAATCCTGATATTAAGCAAGTCCCAGCAATCTGGCATTGTTCAACCT
GCAGCTTCAAGAAAAAAGAATTGGCTGCAGATACCACGAATAATGTTGCCCATGACTGCT
TGCATGGTGGTAACTGTGTTTTGTGTGACCAGCTCGAGCTGGTGAAGACAGAAGAAGAAG
ATCCCAAGCTTCCCATAAAAATTGAATTAGCTGAAGAAAGAGAGGGGAGCTCCGTCTCAA
GCATGGGGGAAGACAATGAACCAGACCTGTCAACAACTGCCCTGTCAAACTTGTGCAAAC
ACTGTGGCACATGCGAAGACGATGACAAGAGATTCATGGTATGCGGACATCCTTACTGCG
TTTACAAGTTCTATCATATCCGATGCCTGAAAACAAGCCAGCTTGCAATTGAGCAACAAA
AGAAGCTTGGTTGCTGGTACTGCCCCTCTTGCCTCTGCAGAGGGTGCTTCCAAGACAAGG
ATGATGACCAGATAGTCATGTGTGATGGCTGTGATGAAGGTTATCACATATATTGCATGA
GACCAGCACGCAACACTATCCCCAAAGGTAAGTGGTACTGTACATTTTGCAAGATCCGCA
GGGCAGCGGAAGGAATGCATAAGTATGAGGATTCTGTGCTGAAAATACATGGGAATAGTA
AGCATGCTTGTAATGTGAATCAGTCGAAGGATTCTGAAGGTGATGGTACTGAAAAGTGAT
CATCACAATAGCTTTGTGGATTAGCTTCTGAGCTCGCTTGGACAAGCTCAGGAAAAGAGA
TTCTTTGGCCCCTTAGGAGGGCTATACACCGACTTTGATACTGAATCAGTTGTGTAGTTT
ATTTAATTAACTGCCGTTGACATCTACAGGAAGAACTCTTACCTGGTGAAGATGGTGTAT
GTAGTCTTTTAGCTGGGCGGAATGATGTGTTGTTTACTTGTTCACCTTCCTTCTTTACCC
CCTTTCAGTGACCATTGTGAATGTTGTCCTGTACTTGCCCTGTGATGGTATTCTTAAACG
TTTTTTTGGGGGAAATATGATTTTGTTTTTTTAATCTCCTTTTTATTGCTTGATTCGTCA
TTGTTTATAGCCTGTGATCGATGATTGTGAAGGTTTATAGTCTGTATGTTGTGTATGTAA
TGGTTTGGTTGATCCTGAAGCTTTTTGGAGGTCTTATTTCAGTCGAGGACAAGCATGAGA
GTCAAGGAAGAAAGTGGATCTTCATTTTGTCAGACAATTGTGACAGTCATGGAGCATGTA
AGTAGTACTAGTATATAGTTTGAGTGTATGACTAACCCTGAATATTCATTCCTATAGTAA
ATAGTACTCCTATATCATATTAGAGATTCTGTGGTTGGATTAATAAGTAGTGTAGCTATA
TCTCCAGATGATGAATTTATATGTGTCCTTGATATGAATTAATGATATTTGTGGTGAGTG
TTGACCTC

CDS

1692 bp

>Os08t0105000-01 Homeodomain (PHD) transcriptional regulator, Flowering promoter
ATGGGCTCCCAGAACCGCCCCCCACCACCGCGCAAGAGGCAGCCGCCGCCGCCGGAGGAC
CACCTCGTCACCTACAAGCGCCGCCGCTCCAAAGAAACACAGCCTTTGCCACTCATGGCC
AACGGCGCCAATTCTAAGAAAGACGCCAAGGCCCAACATTGGATTAGCTGGAGGGACACT
CTCCACGGCTTCCTCCAATCCCCTGCTATTAGCCAGGGTGGAGGAATTCAGACCTGCATC
CGTCATGCTCTCCAACACAATCCTTGCTTGCTCACCAATGGTGTTGTTGTTCACACTGAA
TTCAAAGGTAACCCAGCTCATTCCCAAGGAGAGGAAGCAAAAGTGCAGCACCCTAATGGT
GCTGCTGGAGGCAAGGTGGTTTCTGCAGATGCTGCTATACAAGATGCGGCTGCCGCAGCT
TCTTCCGAAGCTAACAAGGCAATGTGTAATAATGCCCTCTTCGACATTTTGGTCTCCCAG
AAATTTGCCTTGTTGTGCCATTTGCTACTTGGGACCTTCCATGTCAATAAACCTGGTGAT
GTCATCGACTTGGAAAAAATCGACGCCAAGATGAGAAATGGAGACTATGCCCACAACCCT
GCACTATTTGACGATGATATCCAGCAGATGTGGGAGAAGTTTGAGCAAGTTGGCCAAGAG
ATGACAGGTCTAGCGAGCAACCTTTCAACCATTTCACGAGTTTCATACCAAAAGCAGGCT
TCTGGATTTTCTGAAGCTGAGGTGGCTGAGCACAGAATAGAGGAAATAAGTTTGCCGGGT
GCTGTCCACGTTGTCACAAAGGAGTCGACTACCACCGTGCAGTTGGCCCCATGTGATTCT
AGTCATTCTACAATACCGAAACGAACTGTGCCACCTGGACGTGATCTGTGCCCTTGCGAT
GGTTGTGGCACCAAGGTAGATGTTGAAGAAGGCCTAATCTGTGATGAATGTGACACCATG
TACCACTTTGCATGTGTCAAGCTACTCAATCCTGATATTAAGCAAGTCCCAGCAATCTGG
CATTGTTCAACCTGCAGCTTCAAGAAAAAAGAATTGGCTGCAGATACCACGAATAATGTT
GCCCATGACTGCTTGCATGGTGGTAACTGTGTTTTGTGTGACCAGCTCGAGCTGGTGAAG
ACAGAAGAAGAAGATCCCAAGCTTCCCATAAAAATTGAATTAGCTGAAGAAAGAGAGGGG
AGCTCCGTCTCAAGCATGGGGGAAGACAATGAACCAGACCTGTCAACAACTGCCCTGTCA
AACTTGTGCAAACACTGTGGCACATGCGAAGACGATGACAAGAGATTCATGGTATGCGGA
CATCCTTACTGCGTTTACAAGTTCTATCATATCCGATGCCTGAAAACAAGCCAGCTTGCA
ATTGAGCAACAAAAGAAGCTTGGTTGCTGGTACTGCCCCTCTTGCCTCTGCAGAGGGTGC
TTCCAAGACAAGGATGATGACCAGATAGTCATGTGTGATGGCTGTGATGAAGGTTATCAC
ATATATTGCATGAGACCAGCACGCAACACTATCCCCAAAGGTAAGTGGTACTGTACATTT
TGCAAGATCCGCAGGGCAGCGGAAGGAATGCATAAGTATGAGGATTCTGTGCTGAAAATA
CATGGGAATAGTAAGCATGCTTGTAATGTGAATCAGTCGAAGGATTCTGAAGGTGATGGT
ACTGAAAAGTGA

Protein

564 aa

>Os08t0105000-01 Homeodomain (PHD) transcriptional regulator, Flowering promoter
MGSQNRPPPPRKRQPPPPEDHLVTYKRRRSKETQPLPLMANGANSKKDAKAQHWISWRDT
LHGFLQSPAISQGGGIQTCIRHALQHNPCLLTNGVVVHTEFKGNPAHSQGEEAKVQHPNG
AAGGKVVSADAAIQDAAAAASSEANKAMCNNALFDILVSQKFALLCHLLLGTFHVNKPGD
VIDLEKIDAKMRNGDYAHNPALFDDDIQQMWEKFEQVGQEMTGLASNLSTISRVSYQKQA
SGFSEAEVAEHRIEEISLPGAVHVVTKESTTTVQLAPCDSSHSTIPKRTVPPGRDLCPCD
GCGTKVDVEEGLICDECDTMYHFACVKLLNPDIKQVPAIWHCSTCSFKKKELAADTTNNV
AHDCLHGGNCVLCDQLELVKTEEEDPKLPIKIELAEEREGSSVSSMGEDNEPDLSTTALS
NLCKHCGTCEDDDKRFMVCGHPYCVYKFYHIRCLKTSQLAIEQQKKLGCWYCPSCLCRGC
FQDKDDDQIVMCDGCDEGYHIYCMRPARNTIPKGKWYCTFCKIRRAAEGMHKYEDSVLKI
HGNSKHACNVNQSKDSEGDGTEK*

5'UTR

chr08:276692..276978 (- strand) : 287 bp

CDS

chr08:276590..276691 (- strand) : 102 bp

chr08:276242..276445 (- strand) : 204 bp

chr08:275832..276152 (- strand) : 321 bp

chr08:274832..274921 (- strand) : 90 bp

chr08:274602..274646 (- strand) : 45 bp

chr08:273583..274512 (- strand) : 930 bp

3'UTR

chr08:272854..273582 (- strand) : 729 bp

FASTA

>Os08t0105000-01 class=Sequence position=chr08:272854..276978 (- strand)
AGTTTCCATT CCCGTTCCGT TATAATAAGA GGAGAGAGAG AGAGATTTTG GGTTTGTCTC CGGCTCCGCT CGCCGCCTCC
AAATCCCGCT CCTCCGCTGC TGCTCCTCTC TGCCGCGGCG AGGCGAGAGA TCCGAATCCA CCGCCACCCG CGCCCACCCC
GCCCGCACAA ACCCTAGTTT TTCCGGGGTT TTGCTTCCCC TCCGCAGCTC CGCTCCGCTC CGTCCGTCGT CTCCTCCCGG
CGGCTCGGCT TGCTGTCCAT GCTGTAGCCG CCCCCCGCAG GTGGCTGATG GGCTCCCAGA ACCGCCCCCC ACCACCGCGC
AAGAGGCAGC CGCCGCCGCC GGAGGACCAC CTCGTCACCT ACAAGCGCCG CCGCTCCAAA GAAACACAGG TAACCAACCA
ACCAACTCCC TGCCTCTTCT TCTTCTTCTT TCTCCAGATT TCCTTTCGAT TTCTACAAGA TTCGTACTCT CGCTTCTTGC
CTCCTCTTAC AATCTCTCAT TACATCTACT TGTTGTGCTT TCTTTTCTTG CAGCCTTTGC CACTCATGGC CAACGGCGCC
AATTCTAAGA AAGACGCCAA GGCCCAACAT TGGATTAGCT GGAGGGACAC TCTCCACGGC TTCCTCCAAT CCCCTGCTAT
TAGCCAGGGT GGAGGAATTC AGACCTGCAT CCGTCATGCT CTCCAACACA ATCCTTGCTT GCTCACCAAT GGTGTTGTTG
TTCACACTGA ATTCAAAGTA ACACACACCA CCTTTGTTTG CATCTACCCT ATATATATTT ATGCAATGAT AATTTTCCTA
ACACATGACT TCTTTCTCAT TACCAGGGTA ACCCAGCTCA TTCCCAAGGA GAGGAAGCAA AAGTGCAGCA CCCTAATGGT
GCTGCTGGAG GCAAGGTGGT TTCTGCAGAT GCTGCTATAC AAGATGCGGC TGCCGCAGCT TCTTCCGAAG CTAACAAGGC
AATGTGTAAT AATGCCCTCT TCGACATTTT GGTCTCCCAG AAATTTGCCT TGTTGTGCCA TTTGCTACTT GGGACCTTCC
ATGTCAATAA ACCTGGTGAT GTCATCGACT TGGAAAAAAT CGACGCCAAG ATGAGAAATG GAGACTATGC CCACAACCCT
GCACTATTTG ACGATGATAT CCAGCAGGTA ATTGTTTCTC TATTGCTCCC ATGAAAGTAA TTTAGCTACT GTTGTTGGAG
GGAAATAATA CTAGCTAGTG TTTATTCTTA TCTTTTATCT AATAAAGATG ATGCATATTA CCTGTACTTA TAAGCGCCCT
CTGTATGCTA AAGCTTAATG TGTTCTCCAT CTATTATTGT TCACAACTCC GTAAATCATA AGAGCAAAAT GTTCTACGTA
CGGCCAGTTG ATAGAATGAT GCTGATGCTC AACTGCTTAT CTGAGCTTCT TTTGCGTTTG CTAGTTAAGA TCTTCCCAAA
TTGTTTGAAC CATCCAAGCA ACAGACTCCT AGGGAGTTTA TCACAACTGA CCTTCTAGAA CTCTGGTTGT TAGGGTTGGA
ACGCTAGTCA ACTTAAATGG TATACTAGCC CTGTTTCTAC ACTATCATGT CTTCGCAACT TTATATGCTC TATTTCTATC
TGTCTGCTTC ATCTGCTGTC CGCAACATGC CAACTCCCTT GCGCTTCATG GTTGATGAAG TGGACCATGG ATAATGTGGT
TGAGCTGGGG TATGACACAC ACAAAATTCT GGAACATCTC ATGCATGCTG CATGTGTAAC CACTCAATGC TGAGGTTTCT
GTCTAAGTCA ACTAGGGTTT TATCACTTGT TTTCTTAAAT GGGCACAACA CAAAAAAGAA AACTTTTATA ATATTTAGTG
CTAGCACATC TCAAAGACCG AACAATTACT CTTCTATATT GATTTCCTTA TCAGTTATCA TTGATATACT TTTTTCATCT
GTGAGTTTTT TTGTTTACAT TATATTGTTC ATGCTCTAAA CATAGAAGTT GTGTAGTAAC ATCTAGGAAA AATTATACGA
TACTGTTGCC TGCTGAGCCT TCCTCTTAAT ACAACTCTCT ATTTGTTTAT TTTGTAGATG TGGGAGAAGT TTGAGCAAGT
TGGCCAAGAG ATGACAGGTC TAGCGAGCAA CCTTTCAACC ATTTCACGAG TTTCATACCA AAAGCAGGTA ATCTGTTGCT
TTATCTTTCA ATTAATGTCT CTAGCGTCGA GATGGTTATA TTTTGACAAT TTGAGTTAAG ATAAATCTAT TACTGCACAC
TTGGCAACCA TGCTGCAATT TGCAGGATGC TTTAGTATAT TGAAATCTTT CCTTTTATGC TGGGCATTAC TAATGGATAA
ATTATTTTAT AGGCTTCTGG ATTTTCTGAA GCTGAGGTGG CTGAGCACAG AATAGAGGTA AGTTGTCTGT TTGAGGATGT
TTGCTAATCA TTGTTCCACA TGCACACTTA ATTAATAATG GTTTTACTAA TTGCATTCTT CATTAGGAAA TAAGTTTGCC
GGGTGCTGTC CACGTTGTCA CAAAGGAGTC GACTACCACC GTGCAGTTGG CCCCATGTGA TTCTAGTCAT TCTACAATAC
CGAAACGAAC TGTGCCACCT GGACGTGATC TGTGCCCTTG CGATGGTTGT GGCACCAAGG TAGATGTTGA AGAAGGCCTA
ATCTGTGATG AATGTGACAC CATGTACCAC TTTGCATGTG TCAAGCTACT CAATCCTGAT ATTAAGCAAG TCCCAGCAAT
CTGGCATTGT TCAACCTGCA GCTTCAAGAA AAAAGAATTG GCTGCAGATA CCACGAATAA TGTTGCCCAT GACTGCTTGC
ATGGTGGTAA CTGTGTTTTG TGTGACCAGC TCGAGCTGGT GAAGACAGAA GAAGAAGATC CCAAGCTTCC CATAAAAATT
GAATTAGCTG AAGAAAGAGA GGGGAGCTCC GTCTCAAGCA TGGGGGAAGA CAATGAACCA GACCTGTCAA CAACTGCCCT
GTCAAACTTG TGCAAACACT GTGGCACATG CGAAGACGAT GACAAGAGAT TCATGGTATG CGGACATCCT TACTGCGTTT
ACAAGTTCTA TCATATCCGA TGCCTGAAAA CAAGCCAGCT TGCAATTGAG CAACAAAAGA AGCTTGGTTG CTGGTACTGC
CCCTCTTGCC TCTGCAGAGG GTGCTTCCAA GACAAGGATG ATGACCAGAT AGTCATGTGT GATGGCTGTG ATGAAGGTTA
TCACATATAT TGCATGAGAC CAGCACGCAA CACTATCCCC AAAGGTAAGT GGTACTGTAC ATTTTGCAAG ATCCGCAGGG
CAGCGGAAGG AATGCATAAG TATGAGGATT CTGTGCTGAA AATACATGGG AATAGTAAGC ATGCTTGTAA TGTGAATCAG
TCGAAGGATT CTGAAGGTGA TGGTACTGAA AAGTGATCAT CACAATAGCT TTGTGGATTA GCTTCTGAGC TCGCTTGGAC
AAGCTCAGGA AAAGAGATTC TTTGGCCCCT TAGGAGGGCT ATACACCGAC TTTGATACTG AATCAGTTGT GTAGTTTATT
TAATTAACTG CCGTTGACAT CTACAGGAAG AACTCTTACC TGGTGAAGAT GGTGTATGTA GTCTTTTAGC TGGGCGGAAT
GATGTGTTGT TTACTTGTTC ACCTTCCTTC TTTACCCCCT TTCAGTGACC ATTGTGAATG TTGTCCTGTA CTTGCCCTGT
GATGGTATTC TTAAACGTTT TTTTGGGGGA AATATGATTT TGTTTTTTTA ATCTCCTTTT TATTGCTTGA TTCGTCATTG
TTTATAGCCT GTGATCGATG ATTGTGAAGG TTTATAGTCT GTATGTTGTG TATGTAATGG TTTGGTTGAT CCTGAAGCTT
TTTGGAGGTC TTATTTCAGT CGAGGACAAG CATGAGAGTC AAGGAAGAAA GTGGATCTTC ATTTTGTCAG ACAATTGTGA
CAGTCATGGA GCATGTAAGT AGTACTAGTA TATAGTTTGA GTGTATGACT AACCCTGAAT ATTCATTCCT ATAGTAAATA
GTACTCCTAT ATCATATTAG AGATTCTGTG GTTGGATTAA TAAGTAGTGT AGCTATATCT CCAGATGATG AATTTATATG
TGTCCTTGAT ATGAATTAAT GATATTTGTG GTGAGTGTTG ACCTC

Locus: Os08g0105000

Loading...

Locus: Os08g0105000

Loading...